KEGG   Arthrobacter sp. PGP41: C3B78_19200Help
Entry
C3B78_19200       CDS       T05450                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
arth  Arthrobacter sp. PGP41
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AUZ36785
UniProt: A0A2L0R4G8
LinkDB All DBs
Position
complement(4185716..4186792)
Genome map
AA seq 358 aa AA seqDB search
MELPVMPPVPPMLAKAVSGIPEGELSYEPKWDGFRSIIFRDGDELEIGSRNEKPMTRYFP
ELVEALKENLPPRCVVDGEIILIGSSGDRLDFDTLQQRIHPAASRVKLLAAQTPASFVAF
DLLALGDDDYTGRPFTERRAALEKALAASKAPVHLTAATTGKDTAEQWFRQFEGAGLDGV
VAKRLDGRYEPDKRVMFKTKHERTADCVVAGYRLHKSGPDAIGSLLLGLYKDDGGLASVG
VIGAFPMKRRQELFEQLQPLVTDFDHHPWAWARQEEGERTPRNAEGSRWSAGKDLSFVPL
RPELVVEVRYDHMEGDRFRHTAQFNRWRPDRDPESCTYAQLEEPVSFDLASVLETGRP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaactccccgtgatgccgcccgtcccgccgatgctcgccaaggccgtcagcggcatc
ccggagggggagctcagttatgaacccaagtgggacgggttccggtccatcatcttccgc
gacggcgatgagctggagatcggcagccgcaacgaaaagcccatgacccgctacttcccg
gaacttgtcgaggcgctgaaggagaacctgccgccacgctgcgtggtggacggcgagatc
atcctgatcggttcctccggcgaccggctggatttcgacaccctccagcagcgcatccac
cccgccgccagccgggtcaagctgcttgcggcgcagacgccggcctccttcgtggccttc
gacctgctggccctgggcgacgacgactacacgggccggccattcacggaacggcgggct
gcgcttgagaaggcgctcgccgccagcaaggcacccgtccacctcaccgctgccaccacg
ggcaaggacacggcggagcagtggttccggcagtttgagggtgccgggctggacggcgtg
gtggccaagcgcctggacggcaggtatgagccggacaagcgggtgatgttcaagaccaag
cacgagcgcaccgccgactgcgtggtggccggttaccggctgcacaagagcgggccggac
gccatcggatccctgctgctgggcttgtacaaggacgacggcggcctggccagtgtgggg
gtgataggcgccttccccatgaagcggcggcaggaactgtttgaacagctccagccactg
gtcaccgattttgaccaccacccgtgggcgtgggcgaggcaggaggagggcgaacggacc
ccgcggaacgccgaaggcagccggtggagcgccggcaaggacctgtctttcgtgccgctg
cgcccggaactggtggtggaggtccgctacgaccacatggagggcgacaggttccgccac
acggcccagttcaaccgctggcggccggaccgggacccggaatcctgcacctacgcgcag
ctggaggagccggtcagctttgacttggcgtcggtgctggagaccggacggccgtag

DBGET integrated database retrieval system