KEGG   Arthrobacter sp. PAMC25564: E5206_02540Help
Entry
E5206_02540       CDS       T06052                                 

Definition
(GenBank) hypothetical protein
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
artp  Arthrobacter sp. PAMC25564
Pathway
artp01100  Metabolic pathways
artp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:artp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    E5206_02540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:artp01004]
    E5206_02540
   01008 Polyketide biosynthesis proteins [BR:artp01008]
    E5206_02540
Enzymes [BR:artp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     E5206_02540
Lipid biosynthesis proteins [BR:artp01004]
 Polyketide synthase
  Component type
   E5206_02540
Polyketide biosynthesis proteins [BR:artp01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     E5206_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc DUF3410 DUF3091
Motif
Other DBs
NCBI-ProteinID: QCB95950
UniProt: A0A4P7SNN8
LinkDB All DBs
Position
555939..556433
Genome map
AA seq 164 aa AA seqDB search
MSLTTRRTTHRLSIDAPEDVIFGLLREAAHWPYLDGLTVYAERVSGDDSIHELRISIVAN
GSLSSSYCRRVFDADRHRAQFRQLDVEAPFHALRGEWEIHRADGQSLVTLSHEYELDAGA
DVEELAERVNRNIDEFSRRELEALRLSSERLAQLLQQHSAGREA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaccacgcgccggaccacgcaccggctcagcatcgatgccccggaggacgtc
attttcggcctgttgcgggaggccgcacactggccgtaccttgatggtctcaccgtctac
gccgagcgcgtcagcggcgacgattccatccacgaactgcggatctcgatcgtcgccaac
gggtccctcagctccagctactgccgccgggttttcgatgcggaccgccaccgtgcacag
ttccgccagctagacgtcgaggctcccttccacgcgctgcgcggtgaatgggaaatccac
cgcgcagacgggcagtccctggtgacgctcagccacgaatacgaactggacgccggcgcc
gacgtcgaggagctcgcggagcgggtcaaccggaacatcgacgagttcagccggcgcgag
cttgaggcgctgcggctcagctccgagcgcctcgcccaactgctgcagcagcactctgct
gggcgggaggcgtag

DBGET integrated database retrieval system