KEGG   Arthrobacter sp. PAMC25564: E5206_15660Help
Entry
E5206_15660       CDS       T06052                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
artp  Arthrobacter sp. PAMC25564
Brite
KEGG Orthology (KO) [BR:artp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:artp01001]
    E5206_15660
Enzymes [BR:artp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     E5206_15660
Protein kinases [BR:artp01001]
 Serine/threonine kinases: Other
  Bacterial family
   E5206_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: QCB98173
UniProt: A0A4P7SYT8
LinkDB All DBs
Position
3356917..3359037
Genome map
AA seq 706 aa AA seqDB search
MQEYASDPLVGTLVDSRYLVQSRLARGGMSTVYLATDRRLERDVALKVLHPHLAEDPQFL
DRLGREAKAAARLSHPHVVGVLDQGDDGRLAYLVMEYIKGHTLRDVINDKGALSPRLALA
LIDPVVEGLGAAHAAGLIHRDIKPENVLIADDGGIKLGDFGLARAISTSTSTGTLIGTVA
YLSPELVLGKQADARSDIYSVGIMLYEMITGRQPFDGDVPIQVAYQHVNSTVDAPSALVP
GLADEVDELVQWCTANDPDKRPVDGNALLSELRHIRRNLSDAELDLQPPAAVPGAPAGPP
GSPDRASSREDRSAPAAAHTEVLGGLQFPTEIIEHGSNPTAVMSGAPPRPAYGPLSAPEE
VPFPGQPDGPGYGAGQGAPATKRAQRKQDREEQKARQRAAATPVRSLREGNSRRRGLLWV
LVLVIAALLAAGAGWFFGMGPGSPGTIPQLANKTVAEAQLLLRTAGFQSTVKDVFDDNVS
PGLVVGSEPVAGQVIRKFQPVSLAVSKGPELFPLPDLAGNTLDQAKSALNGAGMALGPVT
ETYDETAAAGIVLAQAPRSGNPVRHGTPVSLTVSKGPQPIPVPDVRGQEQGAAVKALEAA
GLKAVLSGETVNDRKVPKGAVVAQDPASGNLTRGGAVTLTISKGPKLVDVPSYIGKQANE
ARKALEQLGFEVRVNNILGGFFGTVRDQDPVNTKAPEGSVVTLTVV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaatacgcgtcagaccctctcgttggaaccctggtggacagccggtacctggtt
caatccaggctggcccgcggcggcatgtccaccgtctatctggccacagaccggcggctc
gagcgcgacgtcgcactgaaggtcctgcatccccatctggccgaggatccccagttcctg
gaccgcctgggccgcgaggcgaaggcagccgccaggctctcccacccgcacgtggtgggc
gttctggaccagggcgacgacggccgtctggcctatctcgtgatggagtacatcaagggc
catacgctgcgcgacgtcatcaatgacaagggcgccctctccccccggctcgccctggcc
ctgatcgaccccgtcgtcgaaggcctgggcgccgcccatgccgccggcctcatccaccgt
gacatcaaaccggaaaatgtgctgatcgccgacgatggcgggatcaagctcggcgacttc
gggctggcccgcgccatctctacgtcgaccagcaccgggacgctgatcgggaccgtcgcg
tatctctcccccgaactcgtcctgggcaagcaggcggatgcccgcagcgacatctactcg
gtcggaatcatgctctacgagatgatcaccggccggcagccgttcgacggcgacgtcccc
atccaggtcgcctaccagcacgtcaactccacagttgatgcaccgtcggcgctggtcccc
ggactggcggacgaggtcgatgagctggtccagtggtgcaccgccaacgatccggacaag
cgtcccgtcgacgggaacgcactgctgtccgagctgcggcatatccggaggaacctgagc
gacgccgaactcgacctccagccgccggccgccgtcccgggcgcgccggcagggcctccc
ggcagcccggaccgcgcttcctcccgggaggaccggtccgcgcccgccgctgcccatacc
gaggtgctcggcggcctccagttcccgacggaaatcatcgagcacggcagcaaccccacg
gccgtgatgtccggcgcgcccccgcgcccggcgtacggccccctctcggcccccgaggag
gtgccgttccccggccagcccgacggccccgggtacggcgccgggcagggggccccggcc
accaaacgggcgcagcgaaagcaggaccgcgaagagcagaaggcacgccagcgggccgcg
gccacacccgtccgcagcctgcgcgaggggaacagccgacgccggggcctgctgtgggtc
ctggtccttgtcatcgcggcactgctggcagcgggcgccggctggttcttcggtatgggt
cccggctcccccgggaccattccgcaactggcgaacaagacggtggccgaggcccaactg
ctgctccggacggccgggttccagtccaccgtcaaggacgtcttcgatgacaacgtctcg
cccggcctggtggtcggctccgaaccggtcgccggacaggtgatccggaagttccagccg
gtctcgctcgccgtgtccaaggggccggagttgttcccgctgccggaccttgccgggaat
accctggaccaggccaagtccgccctcaacggcgcagggatggccttggggccggtcacc
gaaacctacgacgaaacggctgccgccggaatcgtcctggcgcaggctccgcgcagcggc
aatcccgtaaggcacggcacgcccgtgagcctgacggtgtccaagggcccgcagcccatt
cccgtgccggatgtccggggccaggagcagggcgccgcggtcaaggcactggaagccgcc
ggtctgaaggcggtgctgtccggggagaccgtcaacgaccggaaggtccccaagggggcc
gtggtggcgcaggatccggcatccggcaacctcaccaggggcggtgcggtgacgctgacc
atttccaaggggccgaagcttgtggatgtcccgagctatatcggcaaacaggccaacgag
gcgcgcaaggccctggagcaactgggtttcgaagtccgggtgaacaacatcctgggcggc
ttcttcggcacggtccgggaccaggatccggtgaacaccaaggctcccgaggggtccgtc
gtcaccctgacggtggtctag

DBGET integrated database retrieval system