KEGG   Arthrobacter sp. U41: ASPU41_05110Help
Entry
ASPU41_05110      CDS       T05053                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00010  Glycolysis / Gluconeogenesis
aru00020  Citrate cycle (TCA cycle)
aru00620  Pyruvate metabolism
aru01100  Metabolic pathways
aru01110  Biosynthesis of secondary metabolites
aru01120  Microbial metabolism in diverse environments
aru01130  Biosynthesis of antibiotics
aru01200  Carbon metabolism
Module
aru_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASPU41_05110
   00020 Citrate cycle (TCA cycle)
    ASPU41_05110
   00620 Pyruvate metabolism
    ASPU41_05110
Enzymes [BR:aru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ASPU41_05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AOT02820
UniProt: A0A1C9WNS5
LinkDB All DBs
Position
complement(1087230..1088783)
Genome map
AA seq 517 aa AA seqDB search
MTLHKFNLPDVGEGLTEAEIVAWKVKPGDTVAINDVLCEIETAKSLVELPSPFAGTVTEL
LVPEGLTVDVGTPIISVSDAAPAAAPVSAAAPASDAPLYGKLEADTSDDGESAGRPAAGP
LVGSGPKADAVKRRRRAAAPATKPAASAGSIAAPVPPAELGAPTAGFPVRASEAGELSGM
EAHDIWISPEAVAHAVRPAPAENIDLRPTLGGAISGLVSRVLAKPPVRKIARDLGIDLAD
VVPTGARGEVTREDLVSYQAQRDAEVDKADTFWGKTGRPQEQRIERIPVKGVRKATARAM
VESAFAAPHVSIFVDVDASRTMEFVKRLKASRDFEGIKVSPLLILAKAVIWAAARNPSVN
ATWVDDPDGSDSAEIHVKHFMNLGIAAATPRGLMVPNIKNAQDLSLKELALALNELATTA
RAGKTQPAQMQGGTLTVTNIGALGIDTGTPIINPGEVAIVAFGTIKQKPWVLDGEVIPRW
ITTLGGSFDHRVVDGDLSARFMADVAAILEEPALLLD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcacaagttcaacctccccgatgtgggcgaagggctgaccgaggccgagatc
gtcgcctggaaggtcaaacccggcgacacggtggccatcaacgatgtcctgtgcgagatc
gagaccgcgaaatccctcgtcgaactgccatcaccgttcgccggaaccgtcaccgaactg
ctcgtccccgagggcctgacagtcgacgtcgggaccccgattatcagcgtgagcgatgct
gcgcccgccgccgccccggtttccgccgccgcgccggcctccgatgctccgctgtacggc
aagctcgaggcggacacctccgacgacggcgaatcggccgggcgcccggccgccggcccc
ctggtcggctccggccccaaggccgacgccgtcaaacgccgccgccgggcggccgccccg
gcaacgaagccggcggcttcggcaggctccattgctgctccggttccgccggccgagctc
ggagccccgaccgccgggttcccggtccgggccagcgaggcaggggaactgtcggggatg
gaggcacacgacatctggatcagcccggaggccgtggcccatgcggtgcgcccggcccct
gctgagaacatcgacctccggcccacactcggcggcgccatcagcggcctggtcagcagg
gtcctggcaaagcctccggtgcgcaaaatcgcccgggaccttggcatcgacctggccgac
gtcgtccccacgggcgcccgcggcgaagtgacccgcgaggacctggtgagctaccaggcg
cagcgagacgccgaggtggacaaggcggacaccttctggggcaagaccggccgcccccag
gaacagcggatcgaacgtattccggtcaagggcgtccgcaaggccaccgcgagggccatg
gttgagtcggcgttcgcggccccgcacgtcagcatcttcgttgacgtcgacgccagccgg
accatggagttcgtcaaacgcctcaaggcctcccgcgatttcgaaggcatcaaggtctcc
ccgcttctgatcctggccaaggcagtcatctgggccgcggcccgcaaccccagcgtcaac
gcgacctgggtggacgacccggacggcagcgactccgccgagatccatgtcaagcacttc
atgaacctcggaatcgccgccgccacaccgcgcggcctgatggtcccgaacatcaagaac
gcccaggatctctcgctcaaggaactggccctggccctgaatgagcttgccacgaccgcc
cgggccggtaagacccagcccgcacaaatgcagggcggcaccctgaccgtcacgaacatc
ggcgccctcgggatcgacacgggcactccgatcatcaaccccggcgaggtggcgatcgtg
gccttcggcaccatcaagcagaagccctgggtcctcgacggcgaagtgatcccgcgctgg
atcaccaccctcggcggctccttcgaccaccgtgtggtggacggtgacctctcggcgcgg
ttcatggccgacgtcgcggcgatcctggaagagcccgcgctgctgctcgactga

DBGET integrated database retrieval system