KEGG   Arthrobacter sp. U41: ASPU41_08215Help
Entry
ASPU41_08215      CDS       T05053                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00010  Glycolysis / Gluconeogenesis
aru00020  Citrate cycle (TCA cycle)
aru00620  Pyruvate metabolism
aru01100  Metabolic pathways
aru01110  Biosynthesis of secondary metabolites
aru01120  Microbial metabolism in diverse environments
aru01130  Biosynthesis of antibiotics
aru01200  Carbon metabolism
Module
aru_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASPU41_08215
   00020 Citrate cycle (TCA cycle)
    ASPU41_08215
   00620 Pyruvate metabolism
    ASPU41_08215
Enzymes [BR:aru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ASPU41_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AOT03326
UniProt: A0A1C9WPW2
LinkDB All DBs
Position
complement(1763038..1764018)
Genome map
AA seq 326 aa AA seqDB search
MKSSYREALRAGIRDAMLRDERVFLMGEDVGSYGGSFAVSLGLLEEFGPERIRDTPLSES
GFVGAGIGAALAGMRPIVEIMTVNFSLLALDQIVNNAASLLHMSGGQFNVPIVIRMTTGA
GRQLGAQHSHSLEGWYAHIPGLRILAPATLADARGMLWTALEDPDPVLIFEHGSLYNVTG
ELDDDAGPVDIDTAAIRRPGADITLITYGGTLPAVLDAAAQLADEGIDAEVLDLRTLRPL
DETAVLASVRKTHRAVVVDEGWRSGSISAEISARITENAFYDLDAPVGRVCSAEVPIPYS
KHLELAALPSVDRIIAAARQAVSAGE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccagctaccgcgaggcgctccgtgctggaatccgcgacgcaatgctccgcgac
gaacgtgtctttctgatgggcgaagacgtcgggtcctacggcggatccttcgccgtgagc
ctggggctgctggaggagttcggcccggaacgcatccgcgacaccccgctctcggagtcc
ggtttcgttggcgccggcatcggggcggccctggccgggatgcgccccatcgtggagatt
atgacggtcaatttcagcctgctggccctggaccagatcgtcaacaacgcggcgagcctg
ctgcacatgtccggcgggcaattcaatgttccgatcgtgatccggatgaccacgggcgcc
ggccgccagctcggcgcccagcactcgcacagtctggagggctggtacgcccacatcccc
ggcctgcgcatcctcgcccccgccaccctggccgacgcccgaggcatgctgtggaccgcg
ctggaggaccccgatccggtgctgatcttcgagcacggctcgctctacaacgtgaccggt
gagctcgacgatgatgccggcccggtggacatcgacaccgccgcgatccggcggccaggc
gcggacatcacactgatcacctacggcggaacgctccccgcggtgctcgacgccgccgcc
cagctcgcggacgagggaatcgatgccgaagtgctggacctgcgcaccctccgccccctc
gacgagaccgccgtcctcgcctccgtccgtaagacccaccgcgccgtcgtcgtggacgag
gggtggcgcagcggaagcatctccgccgaaatcagtgcccggatcaccgaaaacgcgttc
tatgacctggacgccccggtgggccgggtctgcagcgccgaagtgccgatcccctactcc
aagcatctggaactcgcggccctgccgtctgtggaccggatcatcgcggcggccaggcag
gcggtcagcgccggtgaatga

DBGET integrated database retrieval system