KEGG   Arthrobacter sp. U41: ASPU41_08665Help
Entry
ASPU41_08665      CDS       T05053                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00620  Pyruvate metabolism
aru00680  Methane metabolism
aru01100  Metabolic pathways
aru01120  Microbial metabolism in diverse environments
aru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aru00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASPU41_08665
  Energy metabolism
   00680 Methane metabolism
    ASPU41_08665
Enzymes [BR:aru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ASPU41_08665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SPATA1_C
Motif
Other DBs
NCBI-ProteinID: AOT03403
UniProt: A0A1C9WQR8
LinkDB All DBs
Position
1858853..1861672
Genome map
AA seq 939 aa AA seqDB search
MADTATNPGADLASELRADVRRVSTLLGESLVRQHGPELLDLVEQVRLLTKESKEAARGG
ADATGPWSSYDVVAQVRELLGSLPLEQATDLVRAFAFYFHLANAAEQVHRVRGLRTRQEK
DGWLAKAVTDIAAQAGPSVLQAVVNELDVRPVFTAHPTEASRRSVLDKVRRLSDILAETT
AEGTSARRRQDRQLAEVIDQMWQTDELRQVRPTPVDEARNAIYYLTGILGDALPEMLSDL
SELLGEHGVTLHVEKAPIRFGSWIGGDRDGNPNVTAAVTREILQIQNQHAVRISITLIDG
LISILSNSTALAGADLELLDSIDVDLKNLPGLDRRVLELNAQEPYRLKLTCIKAKLLNTA
RRVSAGSAHEPGRDYTATAELLAELGLLERSLRNHHAALAADGALARVRRAIASFGLHLA
TLDIREHADHHHDAVGQLMDRLGGPGVRYGELSRSERLEVLGSELASRRPLSGHPIKLDG
VADGTYDVFREIRRALRTYGPDVIETYIISMTRGADDVLAAAVLAREAGLVNLFGETPYA
RIGFAPLLETVEELRASAEIVDQLLSDASYRELVRLRGDVQEIMLGYSDSNKESGVMTSQ
WEIHKTQRKLRDIAAKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQG
EVISDKYSLPELARENLELSLAAVMQGSALHRTPRTSEDQRERYGHVMETISDAAFARYR
TLIDDPDLPAYFMASTPVEQLGSLNIGSRPSKRPDSGAGLEGLRAIPWVFGWTQSRQIVP
GWFGVGSGLKAAREAGHSAQLVEMMDGWHFFRSVLSNVEMTLAKTDMDIAGYYVSTLVPE
ELHHLFRAIRAEYELTVTEIQLLTGEALLLDAQPTLKRSLEIRDQYLDPISYLQVELLRR
IRSESAAGESMPNAEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggctgacactgcaacgaaccccggcgccgatctcgcctccgaactgcgggccgacgtc
cgccgggtgtccaccctcctcggcgaatccctggtccgccagcacgggcccgagctgctg
gacctggtggagcaggtgcgcctgctgaccaaggagtccaaggaagccgcccgtggcggc
gcggatgccaccgggccgtggagctcgtacgacgtcgtcgcccaggtccgcgaactgctc
ggctcgctgccgctggagcaggcgaccgacctggtccgcgccttcgccttctacttccac
ctggccaacgcggccgagcaggtgcaccgggtccgcgggctgcgcacccggcaggaaaag
gacggctggctggccaaagcggtcaccgacatcgccgcccaggccggcccctccgttctg
caggccgtggtcaatgaactcgacgtccgccccgtcttcaccgcgcaccccaccgaggcg
tcccgccgctccgtgctggacaaggtccgccggctctccgacatccttgccgagaccacc
gcggagggcacgtccgcccgccgccgccaggaccggcagctcgccgaggtcatcgaccag
atgtggcagacggacgaactccgccaggtccggcccaccccggtggacgaagcccggaac
gcgatctactacctcaccggaatcctcggcgacgccctgccggaaatgctctcggacctc
tcggagctgctcggcgaacacggcgtcaccctccacgtggagaaggcgcccatccgcttc
ggctcctggatcggcggcgaccgggacggcaacccgaacgtcaccgcagccgtcacccgc
gaaatcctgcagatccagaaccagcacgccgtccggatcagtatcaccctgatcgacggg
ctgatctccatcctgtcgaactcaacggcactcgccggggcggacctggagctgctggac
tcgatcgacgtcgacctcaagaacctgccgggtttggaccgccgggtccttgaactgaac
gcccaggagccctaccggctcaagctcacctgcatcaaggccaagctgctgaacaccgcc
cggcgggtttcggccggatcggcgcacgagccgggccgcgactataccgccaccgcggag
ctcctcgccgagctgggcctgctggagcgctcgctccgcaaccaccatgccgcgctcgcc
gccgacggcgccctggcccgggtccggcgcgccatcgcctccttcggcctgcacctggcc
acgctcgacatccgcgaacacgccgaccaccaccacgacgccgtcgggcagctgatggac
cgcctcggcgggccaggcgtccggtacggggaactcagccgttccgagcggctcgaggtg
ctcggttccgagctcgcctcccgccgcccgctctccggccacccgatcaagctcgacggc
gtcgccgacggcacctacgacgtcttccgcgagatccggcgggccctgcgcacctacggc
ccggacgtcatcgagacgtacatcatttcgatgacccgcggcgcggacgacgtcctggcc
gcggcggtgctggcccgcgaggcggggctggtcaacctcttcggcgagaccccctatgcc
aggatcggcttcgcgccgctcctggaaaccgtggaggagctgcgggcctcggccgaaatc
gtggaccagctgctctcggatgcctcctaccgcgagctggtccggctgcgcggggacgtg
caggaaatcatgctcggctattcggactccaacaaggagtccggcgtcatgaccagccag
tgggagatccacaaaacccagcgcaagctccgggacatcgcggcgaagcacggggtgcgg
gtgcgcctgttccacggccgcggcggctccgtgggccgcggcggcgggccgacctacgat
gccatcatggcgcagccgaacggggtgctggaaggcgagatcaagttcaccgaacagggc
gaggtcatttcggacaagtactcgctgccggaactcgcccgcgagaacctcgaactctcg
ctcgcggcggtcatgcagggctccgcgctgcaccgcaccccgcgcacctcggaggaccag
cgcgaacgctacggccacgtgatggagaccatttccgacgccgccttcgcccggtaccgg
acactgatcgatgacccggacctgccggcctatttcatggcgtccaccccggtggaacag
ctggggtccctcaacatcggctcccggccgtccaaacggcccgattccggcgcagggctc
gaaggcctgcgggcgatcccttgggtgtttggctggacgcagtcgcggcagatcgttccc
ggctggttcggtgtgggctccgggctcaaggccgcccgcgaagccggccactcggcccag
ctggtggagatgatggacggctggcatttcttccgctcggtgctctccaacgtggaaatg
acgctggcgaagacggacatggacatcgccggctactacgtctccaccctggtccccgag
gagctgcaccacctgttccgtgccatcagggccgaatacgagctgaccgtcaccgagatc
cagctcctgaccggcgaggcactgctgctcgacgcgcagccgacgttgaagcgctcactg
gagatccgggaccagtacctcgacccgatcagctacctccaggtggaactgctgcgccgc
atccgctccgagtccgcggccggggagagcatgcccaatgccgagatcgacgaacgcctc
cagcgtgccatgctcatcacggtcaacggcgtggcggcgggcctgcgcaacacgggctga

DBGET integrated database retrieval system