KEGG   Arthrobacter sp. U41: ASPU41_11820Help
Entry
ASPU41_11820      CDS       T05053                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00970  Aminoacyl-tRNA biosynthesis
aru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aru00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ASPU41_11820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aru03029]
    ASPU41_11820
Enzymes [BR:aru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ASPU41_11820
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ASPU41_11820
Mitochondrial biogenesis [BR:aru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ASPU41_11820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOT03902
UniProt: A0A1C9WSC6
LinkDB All DBs
Position
2602184..2603752
Genome map
AA seq 522 aa AA seqDB search
MTENNELIRSSAAALAGKLAAREVSAVEVTQAHLDRIAAVDGKVHAFLHVNTDEALAVAA
EVDAIRAAGGAAAEELHALAGVPIAVKDLIVTVGQPTTAGSKILEGWHSPYDATVVKRLR
AAKMPILGKTNLDEFAMGSSTEHSAFGPTHNPWDLDRIPGGSGGGSAAAVAAFEAPLALG
TDTGGSIRQPGAVTGTVGVKPTYGGVSRYGAIAMASSLDQIGPVSRTVLDSALLHQVIGG
HDPHDSTSLPDPLEDLVAAASTGNVRGMRIGIIKELHGEGYQAGVENRFNESLELLRGAG
AEIVEVSCPNFKYALGAYYLIMPSEASSNLAKFDGVRYGLRVLPEDGPMTIERVMGATRA
AGFGDEVKRRIILGTYALSAGYYDAYYGSAQKVRTLIQRDFDAAFAKADVLISPTAPTTA
FKLGEKLNDPLAMYLNDVATIPANMAGVPGLSLPGGLADEDGLPVGVQLLAPARQDARLY
RVGAVLESLLEAQWGGPLLDRAPSLTADPALNDAVASHGGSH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacaacgaactgatccgctcctccgccgcagcgctcgccggcaagctggcc
gcccgcgaagtttccgccgtcgaggtcacccaggcgcacctggaccgcatcgccgccgtc
gatggcaaggtccacgccttcctgcacgtcaacacggacgaggcgctcgccgtcgccgcc
gaggtggacgcgatccgcgccgccggcggcgccgctgccgaggagctccatgccctcgcc
ggtgtgccgatcgccgtcaaggacctgatcgtcacggtcggccagcccaccacggccggc
tcgaagatcctcgaaggctggcacagcccgtacgacgccaccgtggtcaagcgcctgcgc
gccgcgaagatgccgatcctgggcaagaccaacctggacgagttcgcgatgggctcctcc
accgagcactccgccttcggccccacccacaacccctgggacctggaccggatccccggc
ggttccggcggaggctccgcagccgccgtcgcggccttcgaagccccgctggccctcggc
accgacaccggcggctcgatccgccagcccggcgccgtcaccggcacggtcggcgtcaag
cccacctacggcggggtctcccgctacggcgccatcgccatggcctcctcgctggaccag
atcggcccggtctcccgcaccgtgctggactccgccctgctgcaccaggtcatcggcggg
cacgatccgcacgactccacctcgctgccggacccgctggaggacctggtggccgccgcg
tcgaccggcaacgtgcgcggcatgaggatcggcatcatcaaggaactccacggcgagggc
taccaggccggcgtcgagaaccgcttcaacgaatccctcgagctgctcaggggcgccggc
gcggaaatcgtcgaggtctcctgccccaacttcaagtacgccctgggcgcctactacctg
atcatgccctccgaggcctcctccaacctggccaagttcgacggcgtccggtacggcctg
cgcgtgctgcccgaggacggcccgatgaccattgaacgcgtcatgggcgccacccgcgcc
gccggcttcggcgacgaggtcaagcgccgcatcatcctgggcacctacgcgctgagcgcc
ggctactacgacgcctactacggctcggcccagaaggtgcgcaccctgatccagcgcgac
ttcgacgccgcgttcgccaaggccgacgtgctgatctccccgacggcgcccaccacggcg
ttcaagctcggcgagaagctcaacgacccgctggcgatgtacctcaacgacgtcgccacg
attcccgccaacatggccggcgtcccgggcctgtcgctgcccggcggcctggccgacgag
gacggactgccggtcggcgttcagctgctggccccggcccgccaggacgcccggctgtac
cgcgtcggtgcggtgctggaatccctgcttgaggcgcagtggggcggcccgctgctggac
cgcgccccttcgctgacggccgaccctgccctgaatgacgccgtcgcgagccacggaggt
tcccactaa

DBGET integrated database retrieval system