KEGG   Arthrobacter sp. U41: ASPU41_18440Help
Entry
ASPU41_18440      CDS       T05053                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00473  D-Alanine metabolism
aru00550  Peptidoglycan biosynthesis
aru01100  Metabolic pathways
aru01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aru00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ASPU41_18440
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ASPU41_18440
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ASPU41_18440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aru01011]
    ASPU41_18440
Enzymes [BR:aru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ASPU41_18440
Peptidoglycan biosynthesis and degradation proteins [BR:aru01011]
 Precursor biosynthesis
  Amino acid ligase
   ASPU41_18440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOT05005
UniProt: A0A1C9WUX7
LinkDB All DBs
Position
complement(4039961..4041106)
Genome map
AA seq 381 aa AA seqDB search
MSEENVSAEGLSPRPRPRVAVLFGGRSSEHAVSCVTAAGVLGAIDQTKYEVIPIGIAKTG
QWVLASGDTHDWSLSASSLPEVASSARTVALAEIGGEHQLIVASPNEIPQELGAVDVVFP
LLHGPFGEDGTIQGFLELSDTRYVGAGVLASAVGMDKHFMKVVFEAAGLHVGPYIAVTDR
QWRNDPETVRKRVDKLGFPVFVKPARAGSSMGISKVDSLEGLDAAIEAAREHDPKLVIEA
GIVGREIECAVLEGRGTDAPRTSMPGEISVAGGGHEFYDFNAKYVDDAADLSCPADLPDE
AITRVRELAAVAFDAVGAEGLSRVDFFYTPDGELIINEINTMPGFTPKSMYPQMWKASGL
GYAELIDELIYLALHRKTGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaagaaaacgtgagcgcagagggcctgagcccccgtcccaggccccgcgttgcg
gtgctgttcggcggccgttccagcgaacacgccgtcagctgcgtgacggctgccggggtc
ctcggcgcgatcgaccagacgaagtacgaggtcatcccgatcgggatcgccaaaaccggc
cagtgggtgctggcctccggggacacccacgactggtcactctcggcatcctccctgccc
gaggttgcatcctcggcccggaccgtggcgctggccgaaatcggcggcgaacaccagctg
attgtggcctccccgaacgagatcccgcaggaactgggcgccgtggatgtggtcttcccg
ctgctgcacggcccgttcggggaggacggcaccatccaggggttcctggagctgtccgac
acccgttatgtcggcgccggggtgctggcgtccgccgtgggcatggacaagcacttcatg
aaggtggtgtttgaagccgccgggctccatgtggggccgtacatagccgtcactgaccgg
cagtggcgcaacgaccccgagaccgtccgcaagcgggtggacaagctcggcttcccggtc
ttcgtcaagcccgcacgggcgggttcctccatgggcatctccaaggtggactccctcgaa
ggccttgacgcggccattgaggccgcccgtgagcacgatccgaaactcgtcatcgaggca
ggcatcgtgggccgcgagattgagtgtgccgtactggagggccgggggaccgacgctccc
cggacgtccatgccgggagagatttccgtggccggcggcgggcacgagttctatgacttc
aacgccaaatacgtggatgacgccgcggacctcagctgcccggccgacctcccggacgag
gccatcacccgggtccgcgagctggctgccgtggcgtttgacgccgtcggggcggaggga
ctgagccgggtcgacttcttctacacacctgacggcgaactcatcatcaacgagatcaac
accatgcccgggttcacgccgaagagcatgtacccgcagatgtggaaggcctccggcctg
ggctacgcggaactgatcgacgaactgatctatctggcgctgcaccgcaagaccggactg
cggtag

DBGET integrated database retrieval system