KEGG   Aeromonas rivipollensis: C7N77_01575
Entry
C7N77_01575       CDS       T05453                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
arv  Aeromonas rivipollensis
Pathway
arv03030  DNA replication
arv03430  Mismatch repair
arv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:arv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C7N77_01575
   03430 Mismatch repair
    C7N77_01575
   03440 Homologous recombination
    C7N77_01575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:arv03032]
    C7N77_01575
   03400 DNA repair and recombination proteins [BR:arv03400]
    C7N77_01575
Enzymes [BR:arv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C7N77_01575
DNA replication proteins [BR:arv03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C7N77_01575
DNA repair and recombination proteins [BR:arv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C7N77_01575
SSDB
Motif
Pfam: DNA_pol3_chi PP28
Other DBs
NCBI-ProteinID: AVP92044
UniProt: A0A2P1PB38
LinkDB
Position
320205..320660
AA seq 151 aa
MSQVTFYLMSEPDDVQASAVERLACQLAADGWSAGHLYLFCNDEAQALRLDELLWQLPPD
RFVPHQLQGESGQAPVEIGHQPPKRRYARLINLADQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHTLEMRDQPVLAAPDPAQP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagtgagccagacgacgttcaggcgtctgcggtc
gaacgcctcgcctgccagctggcagccgatggctggagtgccggccacctctatctgttt
tgcaacgacgaggcccaggccctgcgcctggacgagctgttgtggcaactgccaccggat
cgtttcgtgccgcaccagttgcagggggagagcggccaggccccggtggagataggccat
cagccaccgaaacggcgctatgcccgcctcatcaacctggccgaccagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcgggccacaccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

DBGET integrated database retrieval system