KEGG   Aeromonas rivipollensis: C7N77_12590Help
Entry
C7N77_12590       CDS       T05453                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
arv  Aeromonas rivipollensis
Brite
KEGG Orthology (KO) [BR:arv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7N77_12590
Enzymes [BR:arv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7N77_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AVP93939
UniProt: A0A2P1PGH4
LinkDB All DBs
Position
complement(2711293..2712879)
Genome map
AA seq 528 aa AA seqDB search
MLDTNLKQQLNGYLQYIVNPIEISVSGNDSDKSAELLALANEIAEMSPKISMTDGTAARK
PSMSVAPQGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADPAVLEQVKNLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRTSLEEIVAKLDTGAAERKAAELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAINKDGYVNVE
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNAAPEAHAVKADAVTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaacctcaaacaacaactcaacggttacttgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaatgacagcgacaaatccgcagagctcctggcattggcc
aacgagatagcagagatgtcccccaagatttccatgaccgatggcaccgccgctcgcaag
ccttccatgagcgtggcgccacaaggccaggcaccgcgcgtgcattttgccggcatcccc
atgggtcatgaatttacctccctggtgctcgccctgctgcaaagcggcggtcacccctcc
aaggccgatccggccgtgctggagcaggtgaaaaacctcaagggcgagttccacttcgag
acctatatttccctctcctgccacaactgcccggacgtggtacaggccctgaacctgatg
gccaccctgaaccccggcatcacccacaccatgatcgacggtgccctgttccaggatgag
gtgaacgagcgccagatcatggcggtgccgaacgtctacctgaacggccagccgttcagc
cagggtcgcacctcgctcgaggagatcgtggccaagctcgataccggcgcggccgagcgc
aaggccgcagagctgagcgaaaaggccccctatgacgtgctggtggtgggtggtggcccg
gctggcgctgctgccgccatctatgccgcccgcaaggggatccgcaccgccatcgtcgcc
gagcgcttcggcggtcaggtgatggacaccgtcggcatcgagaacttcatctcagtgccc
tacaccgagggccccaagctggccgccagcctggagcagcacgtcaagcagtacggcgtg
gaagtgatcaccgagcagcgtgccgccgccatcaacaaggatggctatgtgaacgtggag
ctggcctccggtgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgcgatctgaacgtgcctggcgagcttgagtaccgcaccaagggcgtggcctactgcccc
cactgcgacggtcccttcttcaagggcaagcgggtggcggtgataggcggcggtaactcc
ggcatagaagcggccatcgacttggctggcatcgtcgagcacgttaccgtggtggagttc
gccgataccctgcgcgccgacgaggtgctgcagaagaaggctcgctccatgggcaacatc
gacatcatcatgagcgcccgcaccaccgaagtgataggtgacggcagcaaggtggtgggc
atggactacgaggatcgcaccacgggcgagatcaagcacctggcggtggctggcatcttc
gtgcagataggtctggtcccgaacaccgagttcctgaagggaagcgaggtggccctgacc
cgctttggcgagatcgagatcgacaccaagggcgcgacctccctgcccggcgtctatgcc
gcaggggacgccaccacagtgccgttcaagcagatcatcatctccatgggcgccggtgcc
accgcagccctgggtgccttcgattaccttatccgcaatgcggcccctgaggctcatgcc
gtcaaagccgacgccgtgaccgcctga

DBGET integrated database retrieval system