KEGG   Aeromonas rivipollensis: C7N77_13570Help
Entry
C7N77_13570       CDS       T05453                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K07506  AraC family transcriptional regulator
Organism
arv  Aeromonas rivipollensis
Brite
KEGG Orthology (KO) [BR:arv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:arv03000]
    C7N77_13570
Transcription factors [BR:arv03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    C7N77_13570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AVP94103
UniProt: A0A2P1PGZ4
LinkDB All DBs
Position
2931659..2932546
Genome map
AA seq 295 aa AA seqDB search
MQQRRQAGVFDALVSTGARLEDSCWLEPGLGVASWRNRYDQTRYHKPGHHTISVYLLGGE
QTERLDGPGGHGGTGKVCIMPDHHRSEWLVREEFRFFHLYFTPEHLCRIAEQVCDKEGRH
LVLQDKTFIEDPQAAALVQAQLMKLDWQHGVDRMALSHGAWMLMLHAYRHHTREAPGLPE
VRGGLAPAVIRRVQEYLLAHLAEPVTLSGLAREAGLSEYHFARMFGQSLGCPPHRYLQGL
RLQRAKQLLAGSDPLASIAAQCGFSSQAHFGNRFREAFGLSPGQWRAQLSFSCHR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagagacgacaggcgggggtgttcgatgccctggtcagcacgggggcacggctg
gaggactcctgctggctggagcccgggctcggggtggccagctggcgcaaccgctacgat
cagacccgctaccacaagccgggtcaccacaccatcagcgtctatctgctggggggcgag
cagaccgagcgcctcgacggtcccggcggccacggcggcaccggcaaggtgtgcatcatg
ccggatcaccacagatccgaatggctggtgcgcgaggagtttcgcttcttccacctctac
ttcacccccgagcacctctgccgcatcgccgaacaggtgtgcgacaaggaggggcgccat
ctggtgttgcaggacaagaccttcatcgaggatccccaggccgcggccctggtgcaggca
cagctgatgaagctggactggcagcacggggtcgatcgcatggcgctctcccacggcgcc
tggatgctgatgttacacgcctatcgtcaccatacccgggaggcgcctgggcttcccgag
gtgcgagggggcctggcccccgcggtgatccggcgggtgcaggagtatctgctggctcac
ctggccgagcccgtcaccttgagcggactcgcccgggaggcgggcctgagcgaatatcac
ttcgcccgcatgttcggccagagcctgggttgcccgccccatcgctacctgcaggggctc
agactccagcgggccaagcagttgctggcgggaagcgatcccctggccagcatcgccgcc
cagtgcggtttctcctcccaggcccattttggcaatcgttttcgggaggcgttcggcctg
agcccggggcagtggcgcgcccaattgtcattctcttgtcacagataa

DBGET integrated database retrieval system