KEGG   Aeromonas rivipollensis: C7N77_18645Help
Entry
C7N77_18645       CDS       T05453                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
arv  Aeromonas rivipollensis
Brite
Enzymes [BR:arv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C7N77_18645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AVP94996
UniProt: A0A2P1PJI9
LinkDB All DBs
Position
4048221..4048805
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAINKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
ALVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaaccctggaatatcaccacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggcggtgtcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtggcgaacccaccggcgccctggccgatgccatcaacaaggcg
ttcggctccttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaacttcggc
tccagctggacctggttggtgaagaaagctgacggctccctggccatcgtcaacacctcc
aacgccggctgcccgctgaccgaagccgggaccaccccgctgctgaccgtcgacctgtgg
gagcacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaaccttctgg
gccctggtcaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system