KEGG   Aeromonas rivipollensis: C7N77_19660Help
Entry
C7N77_19660       CDS       T05453                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
arv  Aeromonas rivipollensis
Pathway
arv00550  Peptidoglycan biosynthesis
arv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C7N77_19660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:arv01002]
    C7N77_19660
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arv01011]
    C7N77_19660
Enzymes [BR:arv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C7N77_19660
Peptidases [BR:arv01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   C7N77_19660
Peptidoglycan biosynthesis and degradation proteins [BR:arv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C7N77_19660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AVP95170
UniProt: A0A2P1PJZ5
LinkDB All DBs
Position
4257337..4258566
Genome map
AA seq 409 aa AA seqDB search
MSKFARSVILASLLSATAQANQPVPTPDSALPTAQPVPTLNSAPMVVPAAPEISAKAHIL
IDYFSGQVLAEQNADERLPPASLTKMMTSYIVGNELLKGNIKGTDMVTISQNAWSKNYSD
SSKMFIEVGKQVSVDDLNKGIIIQSGNDACVAMAEHLAGSTDSFASLMNAWAAKLGMKDS
QFKNPHGLDAEGHYSTARDMARLGQALIHDQPEEYKIYSQKSFVFNGITQHNRNRLLWDQ
SLQVDGIKTGHVSQVGYNLVSSATNNEGMRLIAVVLGASSEGSRAAESKKLLTYGFRFFQ
SLTPYKAGTELVTQKIWMGDKSEVKLGVDQDVSVLVTRGQGNNLKADFQLESELKAPLAK
GQRVGTVFLKQGDKEIKQVPLVALEEVQEGGLMSRLWDYLVMLVASWFK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatttgcccgttccgttattctggcctccctgctaagcgcgaccgcccaggcc
aaccagccggtaccgacgccggattcggctctgccgactgcccagccggtccccaccctg
aacagcgcccccatggtagtgcctgccgcgccggagatctccgccaaggcccatattctg
atcgactacttctccggtcaggtgctggccgagcagaacgccgacgagcgcctgcccccc
gccagcctgaccaaaatgatgacctcctacatagtcggcaacgagctgctcaaggggaac
atcaagggcaccgacatggtgaccatcagccagaacgcctggtccaagaactactccgac
tcctccaagatgttcatcgaggtgggcaagcaagtctccgtcgatgacctcaacaagggc
atcatcatccagtccggcaacgacgcctgcgtcgccatggccgaacacctggcgggcagc
accgactccttcgccagcctgatgaacgcctgggccgccaagctcggcatgaaagactcc
caattcaagaacccccacggtctggatgcggaaggtcactacagtaccgcccgcgacatg
gcccgcctgggtcaggccctgatccacgatcagcctgaggagtacaagatctactcccag
aaatccttcgtgttcaacggcatcacccagcacaaccgcaaccgcctgctgtgggatcag
tccctgcaagtggatggcatcaagacaggccacgtcagccaggtcggctacaacctggtc
tcctccgccaccaacaacgagggcatgcgcctgatcgccgtggtgctgggcgccagcagc
gaaggctcccgcgccgccgagagcaagaagctgctcacctacggtttccgcttcttccag
agcctgaccccctacaaggcgggtaccgagctggtgacccagaagatctggatgggcgac
aagtccgaagtgaaactcggggtcgatcaggatgtctccgtgctggtcacccgtggtcag
ggcaacaacctgaaggcggacttccagctcgagagcgagctgaaggccccgctggccaag
ggtcaacgcgtcggcaccgtgttcctcaagcagggcgacaaggagatcaagcaggttccg
ctggtcgccctggaagaggtgcaggaaggtggcctgatgagccgtctgtgggattacctg
gtgatgctggtcgccagctggttcaagtaa

DBGET integrated database retrieval system