KEGG   Arthrobacter alpinus A3: MB46_12685Help
Entry
MB46_12685        CDS       T04228                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00220  Arginine biosynthesis
arw00250  Alanine, aspartate and glutamate metabolism
arw00290  Valine, leucine and isoleucine biosynthesis
arw01100  Metabolic pathways
arw01110  Biosynthesis of secondary metabolites
arw01130  Biosynthesis of antibiotics
arw01210  2-Oxocarboxylic acid metabolism
arw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MB46_12685
   00290 Valine, leucine and isoleucine biosynthesis
    MB46_12685
   00220 Arginine biosynthesis
    MB46_12685
Enzymes [BR:arw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MB46_12685
    2.6.1.66  valine---pyruvate transaminase
     MB46_12685
Amino acid related enzymes [BR:arw01007]
 Aminotransferase (transaminase)
  Class I
   MB46_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALV46212
UniProt: A0A0U3R0F2
LinkDB All DBs
Position
complement(2847784..2849001)
Genome map
AA seq 405 aa AA seqDB search
MAEFTQSTKLHNVLYDIRGPVLERAQELEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVVQYYQTRGIQNIHVDDVYLGNGVSELITLSLMALLNNGD
EVLVPTPDYPLWTASVSLAGGRPVHYICDEDNEWWPDLEDLEAKITPKTKGIVIINPNNP
TGAVYPRHIVQGMVDLARKHNLVVFSDEIYEKILYDGAEHINTATVTGDDVLCMTFSGLS
KAYRICGYRSGWLAISGPKSRAADYLEGINLLANMRMCANVPGQHAIQTALGGHQSIEDL
ILPGGRLKEQRDIAYRLLNEIPGVSVNQAKGALYLFPKLDPEVYPIKSDEKFALDLLESQ
KILVSHGTAFNWIRPDHFRLVTLPNVKDLEEAIGRIAEFLSTYKP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcacccagtccaccaagctccacaacgttctctatgacatccgcggaccc
gtcctggaacgggcccaagagttggaggccgaaggccaccggatcctgaagctgaacatt
ggcaacccggctcccttcggctttgaagcgccggatgcgattctggtggacatgatccgc
cacctgccccatgcccagggttacagcgattcccgcggcattttttcggcccgcacagcc
gttgtgcagtactaccaaacgcgtggcatccaaaacatccatgttgacgatgtttacctc
ggcaacggggtcagtgaactcatcaccttgtccctcatggcgttgctgaacaatggcgac
gaggtgctcgtccccacgcccgactacccgctgtggacggcctccgtgagcctggccggc
gggcgccccgtgcactacatctgcgatgaggacaacgaatggtggccggatcttgaggat
ctggaagccaaaatcacgcccaagaccaagggcattgtcatcatcaaccccaacaacccc
acgggcgccgtataccccaggcacattgtgcagggcatggtggatctggcccgcaagcac
aacctggtggtcttctcggatgagatctacgagaagatcctctatgacggtgccgaacac
atcaataccgccaccgtcaccggtgacgacgtgctgtgcatgacctttagcggcctgtcc
aaggcgtaccggatctgtggttaccgctcaggctggctggccatttccgggcccaagtcc
cgtgccgcggactaccttgaaggcatcaacctgctcgcgaacatgcgcatgtgcgccaat
gtccccggacagcacgccatccagacggcattgggtgggcaccagagcattgaggacctg
attctgcccggcggcaggttgaaggaacagcgtgatattgcgtaccgcttgctcaacgaa
attccgggtgtctccgtcaatcaggccaagggcgcgctgtacctgttcccgaagctggac
ccggaggtgtaccccatcaagagcgatgagaagttcgccctggacctgctggaatcacaa
aagattctcgtttcccatggcaccgcgttcaactggatccgccccgatcacttccgcctt
gtcaccttgcccaacgtcaaggatcttgaagaggccattggcaggattgcggagttcctg
agtacgtacaaaccctaa

DBGET integrated database retrieval system