KEGG   Arthrobacter alpinus A3: MB46_13155Help
Entry
MB46_13155        CDS       T04228                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00473  D-Alanine metabolism
arw01100  Metabolic pathways
arw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MB46_13155
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MB46_13155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arw01011]
    MB46_13155
Enzymes [BR:arw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MB46_13155
Peptidoglycan biosynthesis and degradation proteins [BR:arw01011]
 Precursor biosynthesis
  Racemase
   MB46_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALV46290
UniProt: A0A0U2XS67
LinkDB All DBs
Position
complement(2954034..2955230)
Genome map
AA seq 398 aa AA seqDB search
MVSPFVVPVPAPSHGLERQAIIDLSAIANNIRHLREIAAPAKFMAVVKADAYGHGMIQVA
STAVAAGAQWLGTAHVSEGLALRTAGFEVPVLSWLHTPDTDFTAAVANEIDLGCSDWELE
HIVAAARELQRPARIHLKIDTGLGRNGCSRENWSALAEAAMSYEHQGLLRVVGVFSHLAV
ADEPDRPETDRQLERFREAIGVLEAAGAHLEVRHIANTPATLSRPDSHFDMVRVGLGLYG
LSPFEDRTSAQLGLVPAMTLQTQIALCKDVPTGQGVSYGLNFISEVPTTLGLVPVGYADG
IPRIATGGPVRVNGVTYPVVGRIAMDQMVIDLGPNAHEGFAPAVVPGSALGATAVLFGNG
ADGGPLVEQWAAAAGTVNYEIVTRISQRVPRRYVGGAQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ctggtgagccctttcgttgtgccagttccagccccgagtcacggtcttgaacggcaagcc
atcattgacctgtccgcaatcgccaacaacatccgtcatctgcgtgagattgccgcaccg
gctaaattcatggcggtggtcaaggccgacgcctatgggcacggcatgattcaggtggcc
agcacggcggtggcggccggggcgcagtggctgggaacggcccacgtctccgaaggcctc
gctctgcgtacagcggggtttgaggttccggtgttgtcctggctgcacacgccagacacc
gattttacggctgccgtggccaatgagattgacctgggatgttccgattgggaactcgag
cacattgttgccgcggcccgtgaactccagcggccggcccggatccacctcaaaattgat
accgggttgggccgtaacggctgttcccgggaaaattggtccgcccttgccgaggcggcc
atgagctacgagcatcaggggctgttgcgcgtggttggcgtctttagccacctggctgtg
gcggatgaacctgatcgcccggaaacggatcggcagctggaacggttccgcgaggccatt
ggggttcttgaggcggccggggcccaccttgaggtccggcacattgccaataccccggcc
acgctgtcccgccccgattcccattttgatatggtccgggtggggctggggctgtatggg
ctttcgccgtttgaggatcgcacctccgcccagctggggttggttccggccatgaccctg
cagactcagattgcgctgtgcaaggatgtccccacaggccaaggggtctcctacggactc
aattttatttccgaggtgcccaccaccttgggccttgtcccggtggggtacgcggacggc
attccgcgcatcgccacgggtggtccggtccgtgtcaacggagtcacataccccgtggtg
gggcgcatcgccatggaccagatggttattgacctaggacccaatgcccacgaaggcttt
gctccggcagtagttccgggttccgcattgggtgccaccgcggtgctttttggcaacggg
gccgacggtggacctctcgttgagcagtgggcggcggctgccggaaccgtcaactatgag
atcgtgacgcgcataagccagcgagtgccgcgccggtatgtgggtggtgcccagtga

DBGET integrated database retrieval system