KEGG   Arthrobacter alpinus A3: MB46_14870Help
Entry
MB46_14870        CDS       T04228                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00511  Other glycan degradation
arw00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    MB46_14870
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MB46_14870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:arw02042]
    MB46_14870
Enzymes [BR:arw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     MB46_14870
Bacterial toxins [BR:arw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   MB46_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 NPCBM_assoc BNR Sortilin-Vps10 fn3_5 A2M_N
Motif
Other DBs
NCBI-ProteinID: ALV46586
UniProt: A0A0U3QMK8
LinkDB All DBs
Position
complement(3325933..3328587)
Genome map
AA seq 884 aa AA seqDB search
MKSTDTHRRWKKPRTAIAAGALAATLLTTMMAPATAEVEAAPTVAGSYAEQVLAKNGDNA
IDPVLGANYRIPALAHLGDGIVLASYDGRPYGGDSPQPNSILQRRSIDNGKTWGAPTYVA
RGQMPTADKLVYGFSDPSYVVDELTGDVFNFFVYSKDVSFQAGGFGNNDADRKITSAAVA
VSRDKGLTWSMDPAHMPVLPPVDYAAGSEFAGFDGPLITDVVKPVGDSANVGGIQGVFAA
SGAGIQLKFGEHKGRLVQQYTGKVKQASGAIDYQAYSVFSDDHGKTWQRGAFVGTGMDEN
KSVELSNGDVMLNSRASSGGNGGRKIAISKDGGATYGPVTVDTRLSDPVNNASIARMYPN
AAEGSDEAKMLLFSNANSTSGRQNGTIRYSCDDGATWSAGKQFKAGAMSYSTVAPLGDST
FGVFYEGDNNTMTFGKFNAEWLAIECGVELTAKAVTGANGETVQAELTLVNGSEKTITGA
KATFAAQNAWTFGTAAFADVPAGSSATVTVPVTIPASAKAGSYSVTAKASYGTSEFSAVV
PVTVTGGAAPTIGLGVVGSRTDGGRDLAATPYAVGEKLPYQFAVTSLSNVTSNVAPVSGN
FDPFLPPAGGNCRWNNLAMWANYTCGTPRHAVTADELANGFFVPLTAWSVTSTGLASKTF
TFTGSEVDVLARNPELSATAAAVWNDVDGNGLANVGDTVTTTVTATNSGNVTLTGVAGLG
TDHGTLAVGATATFTETRELSTAELSEGAVAERSVALAAANGAKNASKDVLVQAVELPVL
PAMPGFEPSVTRLDLKGQPPVDLGLNTGKYSIGDTVTVKNLPANEWAFAHLNQHGARIGW
FLADAQGTVTFTVPDGTKNGKDTLVVLDGNGGLFSFGTFHVTPN
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaccgacactcaccgccgatggaagaagccccggacggcaatcgccgccgga
gcccttgccgcaacccttttgaccaccatgatggcccccgcaacggcggaggtcgaagcc
gcccccacagtcgcgggaagctacgctgagcaggttctggcaaagaatggcgacaacgcc
attgaccccgtgctgggcgccaactaccgcatcccagcccttgctcacttgggcgacggc
attgtcctggcctcctatgacggccggccctatggcggcgactcgccccagcccaactcc
atccttcaacgccgcagcatcgacaacggcaagacctggggtgcgcccacctatgtggca
cgtggccagatgcccaccgccgacaagctcgtctacggattcagcgaccccagctacgtg
gtcgatgagctcaccggggatgtcttcaacttcttcgtgtactccaaggacgtcagcttc
caggctggcggcttcggcaacaacgacgcagaccgcaagatcaccagcgccgccgtcgcc
gtctcacgagacaagggcctgacttggtccatggacccggcccacatgcccgtgttgccc
ccggttgactacgcggcgggctcggaatttgccggtttcgatggtccgctgatcaccgat
gtggtcaagcccgtgggtgattccgccaacgtgggcggcatccagggcgtctttgcggcc
tccggtgcgggcatccagctcaagttcggcgagcacaagggacgcctggtccagcagtac
accggcaaggtcaagcaggccagcggcgccattgattaccaggcctacagcgtattctcc
gacgaccacggcaagacgtggcagcgcggtgcgttcgttggcaccggcatggatgaaaac
aagtccgtggaactctccaacggcgacgtcatgctcaactcccgcgccagcagtggcggc
aacggcggccgaaagatcgccatctccaaggatggcggcgcaacgtacggccccgtcact
gtggacacgcggctgagtgaccccgtcaataacgcctccattgcacgcatgtacccgaat
gccgcagagggctccgatgaggccaagatgctgctgttctctaatgcgaacagcacctcc
ggacgccagaacggaaccatccgctactcgtgcgacgacggcgccacctggagcgccggc
aagcagttcaaggcaggcgccatgagctattccacagtggccccattgggtgacagcacg
tttggcgtcttctatgagggtgacaacaacaccatgacgttcggcaagttcaacgccgaa
tggctcgccatcgagtgcggcgtcgagctcaccgccaaggccgtcacgggcgccaacggt
gaaaccgtgcaggccgaactgaccctggtgaacggcagcgagaagaccatcaccggagcc
aaggccaccttcgcggcacagaacgcctggaccttcggtacggcagcatttgccgacgtc
cccgccgggtcttccgccaccgtcaccgtcccggtgaccatccccgccagcgccaaggcc
ggaagctacagcgtcacggccaaggccagctatggaaccagcgaatttagcgcagtggtt
cccgtgaccgtcaccggcggcgccgcacccaccatcggcctcggcgtcgtgggctcgcgc
accgacggcggccgcgacctggccgccactccgtacgcggttggcgaaaagctgccgtac
cagttcgccgtgaccagcctcagcaatgtcacctccaacgttgcacccgtttctggcaac
ttcgatccgttcctgcccccggccggcggcaactgccgctggaacaacctggccatgtgg
gccaactacacctgtgggacgccgcgccacgcggtcactgccgatgagctggccaacggc
ttcttcgttcccctgaccgcctggtccgtcaccagcaccggcctggcaagcaagacgttc
accttcactggcagcgaagttgacgtgttggcgcgcaaccccgaactgtcggccaccgcg
gctgccgtgtggaacgacgtcgacggcaacggcctggccaacgtcggcgacaccgttacc
accacagtcaccgccaccaactcaggcaacgtcaccctgacgggtgttgccgggctcgga
accgaccacggcaccttggctgtcggagctacggccacgttcacggaaacccgtgaactt
tcgacggcggaactttccgaaggcgccgtggcggagcgttccgttgcgctcgccgcagcc
aacggcgccaagaatgcgtccaaggacgtcctggtgcaggcggttgaactgcccgtgctc
ccagcgatgcctggctttgagccgtccgtgacccgtttggatctgaagggccagcctccc
gttgatctgggcctgaacacgggcaagtacagcatcggcgataccgtcacggtcaagaac
ctccctgccaatgaatgggccttcgcgcacctgaaccaacacggcgcccgcatcggctgg
ttcctggccgatgcacagggcaccgtcacgtttaccgtccctgatggcacaaagaatggc
aaggacaccctggtggtattggatggaaacggagggctgttctccttcggcaccttccac
gtcacgccgaactaa

DBGET integrated database retrieval system