KEGG   Arthrobacter alpinus A3: MB46_16440Help
Entry
MB46_16440        CDS       T04228                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00040  Pentose and glucuronate interconversions
arw00051  Fructose and mannose metabolism
arw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MB46_16440
   00051 Fructose and mannose metabolism
    MB46_16440
Enzymes [BR:arw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     MB46_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALV47727
UniProt: A0A0U3PE98
LinkDB All DBs
Position
complement(3668573..3669568)
Genome map
AA seq 331 aa AA seqDB search
MAVSVLVRQGELRTEQRPVPAPGPGEVLVRIASVGVCGSDTHYFTEGRIGSFVVDSPLVL
GHEPSGIVVALGDGVTDRSVGQRVSLEPGIPDPLSKQSLAGCYNLDPGVRFFATPPIDGV
FAEYAVHPAAFCHPVPDAVSNDAAALLEPLSVALAARAAGKVQIGDKVLVAGAGPIGLLV
SKVAQLAGAIVTLTDVRAERLEIAGAYGATHTFTAAAQPPVEPEFDVFIDASGAERAILG
GLARLAPRGRAVLVGMGADTIALPVPLVQGRELTITGTFRYANTWPTAIALAASGQVDLD
GLVTSTHGLDGVEAALTAGGNPGALKAVVRP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccgtctccgtcctggtccgccagggcgagctgcgcaccgaacagcggccggttccg
gcaccggggcccggcgaggtcctggtgcggatcgcctcggtgggggtctgcggctcggac
acgcattacttcaccgagggccgcatcggcagcttcgttgtggactccccgctggtgctt
ggccacgagccttcaggcatcgttgtggcgctcggtgacggggtcacggaccgttcagtg
ggccagcgcgtgtcactggagccgggtatccccgacccgctctcgaagcagtcactggct
ggctgctacaaccttgacccgggagtgcgcttttttgccacaccgcccattgatggggtc
ttcgccgaatatgctgtgcacccggcggcattctgccaccccgtcccggatgccgtttcc
aatgacgccgccgccttgttggagccgctcagcgtggcgctggcggcacgtgcagcgggc
aaggtccagatcggcgacaaggtccttgtggccggcgccggacccatcggactgctggtt
tccaaggttgcccagctcgccggggccatcgtcacactcactgatgtgcgggccgaacgc
ctcgaaattgccggagcatacggcgcaacgcatacctttacggcggcagcacagccgcct
gtggagccggagttcgatgttttcattgacgccagcggagccgagcgggccatcctgggt
gggcttgcccggctagccccgcgcggccgagcggtcctggtcggcatgggcgcggacacc
attgcgctgcccgtgccgctcgtgcaaggccgggaactgaccattacgggtacattccgc
tatgcgaatacatggccaactgccatcgcgctggcggcttccggccaggtcgatctcgac
gggctggtcacctcaacccacggcctggacggcgtggaggccgcccttactgctggcggc
aaccccggcgcgctgaaggcagtggtgcgtccgtag

DBGET integrated database retrieval system