Arthrobacter alpinus A3: MB46_16845 Help Entry MB46_16845        CDS       T04228                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism arw  Arthrobacter alpinus A3 Brite KEGG Orthology (KO) [BR:arw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:arw03032]     MB46_16845    03036 Chromosome and associated proteins [BR:arw03036]     MB46_16845    03400 DNA repair and recombination proteins [BR:arw03400]     MB46_16845 DNA replication proteins [BR:arw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MB46_16845 Chromosome and associated proteins [BR:arw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MB46_16845 DNA repair and recombination proteins [BR:arw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MB46_16845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  ALV46900 UniProt:  A0A0U3R2D6 LinkDB All DBs Position 3752687..3752968 Genome browser AA seq 93 aa AA seqDB search MAKNRSELVAEVAAKAETSQTAVNGVLDALFSVFESSVAAGDKITIPGWLSIERTDRAAR TGRNPQTGETIQIAAGHSVKLSAGSKLKAAVKK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcaaagaaccgtagcgaattggttgctgaagttgctgcaaaggctgagaccagccag actgcagtaaacggcgttctggatgctctcttctcggtattcgagagctccgttgcagcc ggcgacaagatcaccatcccgggctggctctccatcgagcgcaccgaccgtgcagctcgc accggccgcaacccccagaccggcgagaccatccagatcgcagcaggccacagcgtgaag ctttccgctggctccaagctgaaggctgctgtcaagaagtaa

DBGET integrated database retrieval system