KEGG   Arthrobacter alpinus A3: MB46_17555Help
Entry
MB46_17555        CDS       T04228                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MB46_17555
Enzymes [BR:arw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MB46_17555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ALV47019
UniProt: A0A0U3QZF5
LinkDB All DBs
Position
complement(3913203..3915254)
Genome map
AA seq 683 aa AA seqDB search
MPSPTREKSSHPDSAAQELRTTRLWESLPGLSYGGDYNPEQWSKDIHVEDIELMQQAGVN
ALSVGIFSWSWLEPLEGQYDFGWLDEIMDNLASAGIKVALATATAAPPAWLVHKHPEILP
VTAEGIVLGPGSRRHYSPSSSVYRRYAAGITRTLAERYKAHPALALWHVDNELGCHVSEF
HGPEDTAAFRAWLARRYGTIEALNEVWGTAFWSQRYGSFEEVRTPGPAPSTLNPTQQLDF
ARFSSWALIDFYSMLVNVIREVTPDIPATTNFMATSATKALDYFDWAKHMDVVANDHYLV
AADPERHIELAFSADLTRGIASGKPWMLMEHSTSAVNWQPRNTPKLPGEMQRNSLAHVAR
GADAVMFFQWRQSRAGSEKFHSAMVPHGGTNTRVWREVVELGAALQAMSPVQGSRVESRT
AIIFDYESWWASELDSHPSADVKYLDLLRAFHRALFLRGITADFVHPSANLDGYDLILAC
TLYSVNDADAANIAAAATRGATVLVSYFSGIVDENDAVRLGGYPGAFRDLLGINVEEFHP
LPVGGAASVDAGWSGRIWSEHVHLAGAEALASFTEYPLEGVPALTRNATGAGSAWYLATF
PDAEALDGIVETLLEESGVAAPAVAASGVELTRRRAADGTGYLFAVNHGTSDAAVAASGR
DLISGTPFAGVLAAGAVAVIAEA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccccgacccgcgagaaatccagccaccctgacagcgcagcccaggagctgcgc
accacccgtttatgggagtcactcccgggcctttcctacggcggggactacaaccccgaa
cagtggtccaaggacatccatgtggaggacatcgagctaatgcagcaagccggcgtcaac
gctctgagcgtcggcatcttttcctggtcctggcttgaaccactcgaggggcagtacgac
ttcggctggctcgatgagatcatggacaatcttgcctcagccggcatcaaggtggccctg
gccacggcgacggcggcaccgccggcctggctcgtccacaagcatcctgagatcctgcct
gtcaccgccgaaggaatcgtgctgggaccggggtcgcggcggcactactcgccgtcgtcg
tccgtctaccgccgctacgcagccgggatcacgcgcacgctcgccgaacgctacaaggcc
cacccggcactggcgctgtggcacgtcgacaacgaactcggctgccacgtcagcgaattc
cacggacccgaagacactgccgctttccgggcctggctggcccggcgttacggcaccatc
gaggccctgaacgaggtgtggggaacggccttctggtcccagcgctatggcagcttcgag
gaggttcggacgccggggccggccccgagcacgctgaaccccacccaacagcttgatttt
gcccgcttcagctcctgggcgctgatcgacttttactccatgcttgttaacgtcatccgc
gaggtcaccccggacattccagccaccaccaacttcatggccacgagcgccacgaaggcc
ctggactactttgactgggccaagcacatggatgtggtcgccaacgatcactacctggtg
gccgccgaccctgaacgccacatcgaattggccttcagcgctgacctgacccgcggcatt
gccagtggaaagccgtggatgctgatggagcattccacatccgccgtcaactggcagccg
cgcaatacgcccaagctgcccggtgaaatgcagcgcaactcgctggcccatgtagcacgc
ggtgccgacgccgtcatgttcttccaatggcgccaaagcagggccggctccgagaaattc
cactcggccatggtgccccacggcggaacgaacacccgggtctggcgcgaggtggtggag
ttgggtgccgccctgcaggccatgtccccggtgcagggctcccgtgtggagtcccggaca
gccatcatctttgactacgaatcatggtgggccagcgagttggactcccaccccagcgcg
gacgtgaaatacctggacctgctgcgcgccttccaccgcgccttgttcctgcgcggcatc
acggcagacttcgttcacccctctgccaatctggacggctatgacctgatcctggcctgt
acgctgtattcggtgaacgacgccgatgccgccaacattgctgctgccgccacccgcggg
gcaaccgttctggtcagctacttcagcggcatcgttgatgagaacgacgccgtccggctg
ggtggataccccggggccttccgcgatctgctggggatcaacgtggaggaattccatcca
ctgcccgtgggcggcgctgccagcgttgatgccggctggtcggggcggatctggagcgaa
cacgtgcatctggcgggggccgaggcgctggccagcttcaccgaatacccgctggagggc
gtccccgccctgacccggaatgccactggcgccggatccgcctggtacctggccacgttc
ccggatgcggaggcgctggacggaatcgttgaaaccttgcttgaggaatccggtgtggca
gccccggcggttgccgcttccggcgttgagctgacgcgccggcgggcagcggacggcacc
ggctacctgttcgccgtcaaccatggcacctctgacgccgcagtcgccgcttcgggcagg
gacctcatcagtggcacaccatttgccggagtgttggctgcgggcgccgtggccgtcatc
gccgaagcctga

DBGET integrated database retrieval system