KEGG   Arthrobacter alpinus A3: MB46_18425Help
Entry
MB46_18425        CDS       T04228                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00620  Pyruvate metabolism
arw00680  Methane metabolism
arw01100  Metabolic pathways
arw01120  Microbial metabolism in diverse environments
arw01200  Carbon metabolism
Module
arw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:arw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MB46_18425
  Energy metabolism
   00680 Methane metabolism
    MB46_18425
Enzymes [BR:arw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MB46_18425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALV47171
UniProt: A0A0U3PSC1
LinkDB All DBs
Position
4100016..4102835
Genome map
AA seq 939 aa AA seqDB search
MSSDLQPNPQGAAQEPEQDTDLRADVRRVSTLLGESLVRQHGPELLAMVEQVRLLTKESK
EAARGESGTGPWSANDVAEQVREVLASLPLEQATDLVRAFAFYFRLANAAEQVHRVRSLR
SRPEKDGWLAKAVTEIAEKAGAEALQKVVNELDVRPIFTAHPTEASRRSVLDKIRKLSDI
LATPSEEGSTARTRQDRKLAEIIDQMWQTDELRKVRPTPMDEARNAIYYLRNILTDAMPE
VLTELSDLLGEHGVSLPADAAPLRFGSWIGGDRDGNPNVTSEVTREVLILQNQNAVKISL
ALIDELVSVLSNSSALYGADAALTDSIAVDLANLPAIDPRVLELNADEPYRMKLTCIKAK
LINTQKRVAADGYHEPGRDYSATSELLGDIELLEASLRNNSAALVADGALASVRRAIASF
GLHLATLDIREHADYHHDAVGQLMDRVGELAKPYADLDRAERLAVLGTELASHRPLSGHP
IELDGAANGTYDVFRVVRRALRTYGPDVVETYIVSMTRGADDVLAPAVLAREAGLVQLTG
ENRYAKIGFAPLLETVDELRASAEIVDQLLSDPSYRELVRLRGDVQEIMLGYSDSNKESG
VLTSQWEIHKTQRKLRDVALKHGVNVRMFHGRGGSVGRGGGPTYDAIMAQPNGVLEGAIK
FTEQGEVISDKYSLPELARENLELSLAAVMQGSALHQAPRHSDDDLERFGAIMEVMSDAA
FDTYRTLIDHEDLPAYFLASTPVEQLGSLNIGSRPSKRPDSGSGLGGLRAIPWVFGWTQS
RQIVPGWFGVGSGLKAAREAGRSEDLKEMLKHWHFFSSTISNVEMTLAKTDMDIAAHYVA
SLVPAELQHLFTTIRAEYDLTVAELQLLTGESELLDNQPLLKRSLNVRDQYLDPISYLQV
ELLRRVREADITKSEVDERLQRAMLITINGVAAGLRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagacttgcaacccaaccctcagggcgccgctcaagaaccggagcaggacaca
gacctgcgtgccgatgtgcgccgcgtcagcaccctcctgggcgaatccctggtccgccag
cacggccccgagctgctggccatggtggagcaggtacgcctgctgaccaaggaatccaag
gaagccgcgcgcggcgaatccggcaccggcccgtggagcgcgaacgacgtcgcagagcag
gtccgtgaggtcctcgcctccctgccactcgagcaggcaaccgatttggtgcgcgccttc
gcgttttacttccgcctagccaacgcggccgagcaggtacaccgcgtgcgcagcttgcgc
tcacgtccggaaaaggacggctggctggccaaggctgttaccgagattgccgaaaaagcg
ggcgccgaggcgctgcaaaaggtcgtcaacgaactcgatgtccgccccatcttcacagct
caccccacggaagcctcacggcgttcggtgttggataagatccgcaagctctccgacatc
ctggccacgccctccgaagagggcagcaccgcccgcactcgccaggaccgcaagctggcc
gaaattattgaccagatgtggcagacagatgagcttcgcaaggtccgtcccacccccatg
gatgaggcccggaacgcgatttactacctgcgcaacatcctcaccgatgccatgccggag
gtcctgaccgagctcagcgacctgctgggcgagcacggcgtctccctgccggccgacgcc
gccccgctgcgcttcggctcctggattggtggcgaccgcgacggcaacccgaatgtcacc
tccgaggtgacgcgcgaggttctgatcctgcaaaaccagaatgctgtgaagatctccctg
gccctgatcgatgagctggtcagcgtcctctccaactccagcgccctctatggtgcggat
gcggcgctgaccgattccatcgccgtcgatcttgccaatctgcccgcgattgacccgcgc
gtccttgaactcaacgccgatgagccttaccgcatgaagctcacctgcatcaaggccaag
ctcatcaacacccagaagcgtgtggctgctgacggctaccatgagcccggccgcgattac
agcgccacctccgagctccttggagacatcgagcttttggaagcatcgttgcgcaacaac
tccgcagcactcgtggccgacggcgcactcgcctcggtacgccgcgccatcgcctccttc
ggcctgcacctggccacgctggatatccgcgagcacgctgattaccaccacgatgccgtg
ggtcagctgatggatcgcgtgggcgagcttgccaagccctacgctgatctggaccgggcc
gagcgcctcgctgttttgggcaccgagctggccagccaccgcccgctgtccggtcacccg
atcgagctcgacggcgcagcgaacggtacgtacgacgtcttccgtgtggttcgccgcgcc
ttgcgcacctacggcccggacgtagtggagacgtacattgtctccatgactcgcggtgcc
gacgatgtcctggcccctgccgtgctggcccgcgaagccggcctggtccagctgacaggc
gagaaccgctacgccaagatcggcttcgccccgctgctggaaaccgtcgacgagctccgg
gcttcggcagaaattgttgaccagctcctctccgatccctcgtaccgcgaattggtgcgc
ctgcgtggagacgtgcaggaaatcatgctcggctactcggactccaacaaggaatccggt
gtgctgaccagccagtgggagatccacaagactcagcgcaagctgcgcgatgtggcgctc
aagcacggcgtcaacgtgcgcatgttccacggccgcggtggttccgtgggtcgcggtggc
ggacccacgtacgacgccatcatggcccagccgaacggcgttctggaaggcgccatcaag
ttcaccgaacagggcgaggtcatctccgataagtactccctgccggaactggcccgtgaa
aaccttgaactctcgctggctgctgtcatgcagggttcggcgttgcatcaggctccgcgc
cactcggacgatgaccttgagcgttttggcgccatcatggaagttatgtccgatgccgcc
tttgatacgtaccggacactcattgaccacgaggacctgccggcctacttcctggcttcc
acccccgtggagcagctcggatcgctgaacatcggctcacgcccgtccaagcgccccgac
tcgggctccggcctgggcggtctgcgagcgatcccgtgggtattcggctggacccagtca
cgccagatcgtgccgggttggttcggtgttggctccggcctgaaggctgctcgtgaggcc
ggccgttccgaagacctgaaggagatgctcaagcactggcacttcttctcctccaccatc
tccaacgtggaaatgacattggccaaaacggatatggacatcgccgcgcactacgtggcc
agcctggttcccgccgagctgcagcacctattcaccacgatccgcgcagaatacgatctc
accgtggctgaacttcagctgctcaccggcgagagcgaactgctggacaaccagccgctg
ctcaagcgttcactgaacgtccgcgatcagtacctggaccccatctcctacctgcaagtt
gaactgctgcgtcgcgtccgtgaagcggacataaccaagtccgaggtggacgagcgcctg
cagcgcgccatgctgatcaccatcaatggtgtggcggccggtctgcgcaacaccgggtag

DBGET integrated database retrieval system