KEGG   Arthrobacter sp. ZXY-2: ARZXY2_162Help
Entry
ARZXY2_162        CDS       T05201                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00040  Pentose and glucuronate interconversions
arx00051  Fructose and mannose metabolism
arx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARZXY2_162
   00051 Fructose and mannose metabolism
    ARZXY2_162
Enzymes [BR:arx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ARZXY2_162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_7 CoA_binding
Motif
Other DBs
NCBI-ProteinID: AOY69729
UniProt: A0A1D9F2Y8
LinkDB All DBs
Position
complement(173764..174813)
Genome map
AA seq 349 aa AA seqDB search
MKAARLHSAGTITVDEVARPVAGPGDLVIKVRAASICGTDRRIAANGHFKLPEGTPRVLG
HEFAGDIVEAGEEVNGYAVGDRVSVTPNVGCGRCTSCLLGLNNMCPSYEAFGITLDGGFQ
EYVLIPRFAIERGNVFHLPDSVDYAEAALVEPLSCCYNAISKLNVGPETTVLVMGAGPIG
ACHVMLSKLYGAAKVIVSNNRQARLDFAGSVGADVLVNLGERELASVVEQETNGRGVDVA
LTCVSKPEVQAEAVDLLAMHGRVNFFAGLGKAQRVPVDTNRVHYQGLTLTGTTGSSNSDY
AASLRLVGQRRLDLSPLVTETFTLDDIEKAMDYAGSGAGMKAMILFDTK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggctgcaaggctccactccgccggcaccatcactgttgacgaggttgcgcgacct
gtcgcgggcccgggcgaccttgtcatcaaggtccgtgcggcctccatttgcggcacggac
cgccggattgccgccaacggccacttcaagctcccggagggaacaccccgcgtcctcggt
catgagtttgccggagacatcgttgaggccggggaggaagttaacggctatgccgtggga
gacagggtcagcgtcaccccgaacgtgggatgcggacgctgcacgagttgcttgctgggg
ctcaacaacatgtgcccttcctacgaagctttcggcatcaccttggacggcggctttcag
gagtacgtcctcattccccggttcgccattgaacgaggcaacgtgttccatctcccggac
tccgtggactacgccgaagccgccttggttgagccgttgtcctgctgctacaacgccatc
agcaagctgaacgttgggccggagaccacggtcctggtgatgggtgccggcccgatcggc
gcctgccatgtgatgctgtccaagctctatggggcagccaaggtcattgtgtccaacaac
cgccaggcccggctcgacttcgccggttccgtgggggctgatgtcctggtgaacctcggc
gaacgcgagctggcgtccgtggtcgagcaggaaaccaacggcaggggcgtggatgtcgcg
ctgacgtgcgtgtccaagccggaagtccaggccgaagcagtggatctgctggccatgcac
ggcagggtgaacttctttgctggcttgggcaaggcacagcgggttcccgtcgataccaac
agggtccactatcaaggcctcaccttgacgggaacaacggggtccagcaattccgactac
gccgcctcgctgcggttggtaggacagagacgcctggacctctcgcccctggtcaccgag
accttcacactggatgacatcgagaaggccatggactacgcaggatcgggcgccggcatg
aaagccatgatccttttcgacacgaagtag

DBGET integrated database retrieval system