KEGG   Arthrobacter sp. ZXY-2: ARZXY2_3227Help
Entry
ARZXY2_3227       CDS       T05201                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00620  Pyruvate metabolism
arx00680  Methane metabolism
arx01100  Metabolic pathways
arx01120  Microbial metabolism in diverse environments
arx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARZXY2_3227 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ARZXY2_3227 (ppc)
Enzymes [BR:arx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ARZXY2_3227 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Se-cys_synth_N
Motif
Other DBs
NCBI-ProteinID: AOY72742
UniProt: A0A1D9FBQ7
LinkDB All DBs
Position
complement(3366826..3369624)
Genome map
AA seq 932 aa AA seqDB search
MVHTAQQSTDLAAELRADVRRVSTLLGESLVRQHGPELLELVEQVRLLTKESKEAARGGA
DATGPWSAHDVVAQVRELLASLPLEQATDLVRAFAFYFHLSNAAEQVHRVRGLRTRQEKD
GWLAKAVSEIAGQAGPEILQDVVNELDVRPIFTAHPTEASRRSVLDKIRKLSDVLAQPTA
EGTSARRRQDRQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDAMPEMLTDLS
ELLAEHGVKLPTGAAPLRFGSWIGGDRDGNPNVTAAVTREILQLQNQNAVRISIALIDEL
ISVLSNSTALFGADQELLDSIEVDLKNLPGLDKRVLELNAQEPYRLKLTCIKAKLINTGR
RISASTYHEPGRDYATTSELLAEFGLLEASLRNHAAGLVADGALARVRRALAAFGLHLAT
LDIREHADYHHDAVGQLVDRLGTEKPYGSLTREERLAFLGEELASRRPLSGHPIKLDGAA
DGTYDVFRSIRQALNTYGPDVVETYIISMTRGADDVLAAAVLAREAGLIDLFGANPHARI
GFAPLLETVEELRASAETVDQLLSDPSYRELVRLRGDIQEIMLGYSDSNKESGVLTSQWE
IHKTQRKLRDVAAKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQGEV
ISDKYSLPELARENLELSLAAVMQGSALHRTPRTSEDQRERYGNVMETISDAAFARYRAL
IDDPDLPAYFLASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVPGW
FGVGSGLKKARESGNTEQLMEMMERWHFFRSVISNVEMTLAKTDMEIAGHYVSSLVPQEL
HRLFHMIRDEYELTVAEVERLTGELELLDAQPTLKRSLEIRDQYLDPISYLQVELLRRVR
EESVSGAEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggttcacactgcccagcaatccactgatctcgccgcggaactgcgagccgacgtccgc
agggtttcaaccctgctgggcgagtcgttggtccggcaacacggtcccgaattgttggag
ctggtggagcaggtccgcctgctgaccaaggagtccaaggaagcggcgcgtggcggcgcc
gatgccaccggaccgtggagcgcgcacgacgtcgtagcccaggtccgcgaattgctcgcc
tccctgccgctggagcaggcaaccgacctggtccgcgctttcgctttctacttccacctc
agcaacgctgccgaacaggtccaccgggtgcgggggctgcggaccaggcaggagaaggac
ggctggctggccaaggccgtttccgaaatcgcgggtcaggcaggtccggagatcctgcag
gacgtagtcaacgaactcgatgtccgcccgatcttcaccgcccaccccaccgaggcctcc
aggcgttcggtcctggacaagatccgcaagctttccgatgtgctggcacagcccactgcg
gaaggcacctcggccaggcgccgtcaggaccgccagctcgccgaaatcatcgatcagatg
tggcaaacggacgagctccggcaagtgcggccgactcccgtggacgaagcgcgcaatgcc
atctactacttgaacagcatcctcaccgatgccatgccggagatgctcacggatctttcc
gagctcctggcagaacacggagtcaagctccccacaggcgccgcgcccttgcgcttcggc
tcctggatcggtggtgaccgggacggcaacccgaacgtcacggcggctgttacccgcgag
atcctccagctccaaaaccagaatgcggtccggatcagcattgccctgatcgatgagctg
atttccgtcctttccaactccaccgcactgttcggcgctgaccaggagttgctggactcc
atcgaagtggacctcaagaacctgcccggcctggacaagcgggtgctggagctcaacgcg
caggagccgtacaggctcaagctcacatgcatcaaagccaagctcatcaatacggggcgt
cgcatctcggcgtcgacgtatcacgagccgggccgcgactatgccacgacctccgaactc
ctcgccgaattcgggctcctggaagcgtcgctccgcaaccacgccgccgggcttgtggca
gacggtgccctggcccgtgtcaggagggcgctcgcagcgttcggtctgcatttggccacc
ttggacatccgtgaacatgccgattaccaccacgacgccgtgggccaactcgtcgacagg
ctcgggacggagaaaccgtatggctccctcacccgcgaggagcgcctcgcgttcctcggc
gaagaactggcgtcccgccggcccttgtccggccaccccattaagctcgacggcgccgcc
gacggtacgtacgacgtcttccggagcattcgccaggccctgaatacgtacgggccggac
gtcgtggaaacctacatcatttccatgacgcgcggtgccgatgacgtgctggcagccgcc
gtgctggcccgcgaagccgggctcattgacctcttcggggcgaatccgcacgcacgaatc
ggtttcgctccgctgcttgagacagtggaagaactgcgtgcttctgcggaaaccgtggac
cagcttttgtctgatccgtcctaccgtgagctcgtccgcctgcgcggggacatccaggaa
atcatgctgggctactcggattccaacaaggaatcgggcgtgctcaccagccagtgggaa
atccacaagacccagcggaagttgcgcgacgtcgctgcgaagcatggtgtccgcgtgcgg
ctcttccacggccgaggtggttcagtggggcgcggcggtggacctacctacgacgccatc
atggcccagcccaacggggtgcttgagggtgagatcaagttcaccgagcaaggcgaggtt
atctcggacaagtactccttgccggagcttgcacgcgaaaacctggaactgtcgctggcg
gcggtgatgcagggctcggccctgcaccgcactccgcgcacgtccgaggaccagcgtgaa
cgctacggcaacgtcatggagaccatttccgacgccgcgttcgcacggtaccgcgccctg
attgacgatcccgaccttccggcctacttcctggcatcgacgcccgtggagcagttgggc
tcgttgaacatcggctcccgcccgtccaagcgtcccgattccggtgcaggcctgggcggc
ttgcgtgcaatcccgtgggtgttcggatggacccagtcccgccagattgttcccggttgg
ttcggcgtcggttcaggcctgaagaaggcccgcgagtccggcaacacggagcagctgatg
gagatgatggagcgctggcacttcttccgttccgtgatctccaacgtcgagatgacgttg
gccaagacggacatggaaattgccgggcactacgtgtcctccttggtgccgcaggaactc
caccggctcttccacatgatccgggacgagtacgaactgacggtcgccgaggtcgagagg
ctcaccggggaactggaactgctggacgcgcagcccacgctcaagcgttcactggaaatc
cgggaccagtatcttgaccccatcagctacctgcaggtggagctccttcgtcgcgtccgc
gaagaatcagtgtccggagctgaaatcgatgagcggctccagcgggccatgctgatcacg
gtcaatggcgttgctgcgggcctgcggaacaccggctag

DBGET integrated database retrieval system