KEGG   Arthrobacter sp. ZXY-2: ARZXY2_3332Help
Entry
ARZXY2_3332       CDS       T05201                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00511  Other glycan degradation
arx00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARZXY2_3332
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ARZXY2_3332
Enzymes [BR:arx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ARZXY2_3332
Bacterial toxins [BR:arx02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ARZXY2_3332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 NPCBM_assoc BNR DUF11 CARDB BNR_3 Sortilin-Vps10 N_BRCA1_IG
Motif
Other DBs
NCBI-ProteinID: AOY72846
UniProt: A0A1D9FBX9
LinkDB All DBs
Position
complement(3484587..3487559)
Genome map
AA seq 990 aa AA seqDB search
MTSNSTSAPSLVRRAATGVLTCAVSIGLLAGLGLPAQAAPTPPNSPTLPPGSFSETNLAA
DRTAANFFYRIPALTYLGNDVVLAAWDGRPGSAADAPNPNSIVQRRSTDGGKTWGPVQVI
AAGHVADASGPRYGYSDPSYIYDAEANKVFAFFVYSKDQGFGGSQFGNDDADRNVISSAV
IESSDAGVTWSQPRLITSVTKPGTSKTNPAAGDVRSNFASSGEGIQLKYGPHKGRLIQQY
AGDVRQADGSNKIQAYSVYSDDHGVTWHKGANVGDRMDENKTVELSDGRVLLNSRDNANQ
GYRKVAVSTDGGATYGPVSQDTELPDPANNGAIARMFPNAAQGSADAKKLIFTNANSKTG
RENVSARVSCDDGATWPGVRTIRPGFSAYSTVTRLADGKFGVLYEGNYTDNMPFATFDDA
WLNYVCAPLAVPAVNIAPSATQEVPVTVTNQEATTLSGATATVYTPSGWSATTVPVPDVA
PGASVTVTVALTAPADASGPRSLNAAFTTADGRVSQFTFTATTPVAPQVGLTITGSAPAR
DVAANPYQAGDVLGYTLNVKSTANVAANSVPLTGTFDSGFLPPAAPNCRYNNLAAGASYN
CTTAKHTITAADMERGYFVPEATFSITSTTTPSLTKTVQFTGAAVALRDGLISADISGAR
TDVGRDLATRPYAAGELVPYAFTVKNTSPFVEQVVPTAGNFSPFLPAGAGNCRYLSLPAG
QSYECATPRHAVTAEEVEQGFFVPDTTWEVGAAGQSTRTYRINGGEVDLLVRDAALSATV
VAEWKDADGDRFASAGDPVTFTYTVGNAGNVALTGLEAPDAGISLPFLAPGDTATATREH
VLTAADVAAGSLAATAFEATARNGSKEVAATAEGQPLELKVQPVQPSNEPELTVQDLEDK
TPPFDLGTAFKYRTGQKVSLAGLEYGQWYYVYLNKTGYRLGWMFPTTGDTVEFILPPEVR
NGRDDVVVLDKDGRQVSFDRLQVTPKGEKI
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
ttgacatccaacagcacctccgcaccatcgctagtccgaagagccgcaaccggcgtactg
acctgcgcggtcagcatcggcttgctggccggcttgggactgcccgcccaggcggccccc
actccgcccaattcgcccacgcttccacctggcagcttctctgaaaccaatctggcggcc
gaccgcacggcggcgaatttcttctaccggattcccgcgcttacctaccttggcaacgac
gtggtccttgcagcgtgggacggtcgcccgggttcggcggcggacgccccgaacccgaac
tcgatcgtccagcgccgaagcacggacggtggcaagacctgggggccggtccaagtgatc
gccgcaggccacgtcgccgatgccagcggccctcgatacggctacagcgatccctcgtac
atctacgacgcggaagccaacaaggtcttcgctttcttcgtgtactcgaaggaccaaggc
tttggcggcagtcagttcggcaacgacgacgcggaccggaacgtcatttcctccgctgtc
atcgagtcctccgacgccggcgtgacatggagccagccccgcctcatcacctccgtcacc
aagccgggtaccagcaagaccaacccggcagccggcgacgtccgctccaactttgcctcc
tccggtgagggcatccagctcaaatacggcccgcacaagggccgtctcatccagcagtac
gccggcgacgtgcggcaagctgacggaagcaacaagatccaggcctacagcgtctattca
gacgatcacggcgtcacgtggcacaagggtgccaacgtgggcgaccggatggacgagaac
aagactgtggaactgtccgacggtcgggtcctgctcaactcccgggacaacgccaaccag
ggctaccgcaaggtggccgtctccacggacggcggagccacgtacggccccgtcagccag
gacacggaattgccggaccctgccaacaacggtgcaatcgcccgcatgttccccaacgcg
gcgcagggctccgcagacgcgaagaaactgatcttcaccaacgcaaactccaagaccggc
cgcgaaaacgtctcggcccgggtctcctgtgacgacggcgcaacctggccgggcgtgcgc
accatccgtcccggcttctcggcctactcgacagtgacacggctggcggacggaaaattc
ggtgtcctctacgagggcaactacacggacaacatgcccttcgccaccttcgacgacgcg
tggttgaactacgtctgcgctcccttggcagtaccggcagtcaacatcgccccgagcgca
acgcaggaggttccggtgaccgtcactaaccaggaagcaaccacgctttccggcgcgacc
gcaactgtctatacgccgtcggggtggtctgccaccacggtgcccgtgcccgacgtcgcc
cccggtgcgtccgtcaccgtgaccgttgcactgaccgcaccggcggacgccagtggcccg
cgcagcctcaacgcggcattcacgacggcggatggccgggtttcgcagttcaccttcacc
gccaccacgcccgtggctccgcaagtgggccttaccatcacgggctcggctccggcacgt
gacgtagcggccaacccgtaccaggccggtgacgtgctggggtacacgctcaacgtcaag
agcaccgcgaatgtggcggccaactccgtgccgttgaccggaacgttcgactccggcttc
ctgcctcccgcggcccccaactgccgctataacaaccttgcagccggagccagctacaac
tgcaccacggccaagcacaccatcacggccgccgatatggagaggggctactttgttccg
gaggccaccttcagcatcacttccacaacgacgccgtcactcaccaagacggtgcagttc
accggcgctgcggtcgccctgcgggatggcctgatttcggcggacatcagcggtgcgcgc
accgacgtcggacgcgacctcgcaacccggccgtacgcggcaggcgagctggttccctac
gcctttacggtcaagaacaccagcccgttcgtggagcaggtggttcctacagccggcaac
ttcagtccgttccttcctgccggggccggaaactgccgctacctgtccctcccggcaggc
cagagctatgagtgcgcgacgccccgtcacgcggtgacggctgaagaagtggagcagggc
ttctttgttcccgacaccacctgggaggtcggcgcagcgggccagagcaccaggacgtat
cggatcaatgggggagaagtggacctgttggtccgcgatgctgccttgtccgccacagtg
gtggccgaatggaaggatgctgacggagaccgcttcgccagcgccggagaccctgtaact
ttcacctacaccgtgggcaacgcgggcaatgtagcgttgacgggccttgaagcgcccgac
gccgggatatcgctgcccttccttgcccccggagacactgccacggcaacacgcgagcac
gtcctgaccgctgctgacgttgcagcaggatcgttggctgccacggcttttgaagccacg
gcccgcaacgggtccaaggaagtagccgcaactgcggaaggtcaacccctggaactcaag
gtgcagccggtgcagccaagcaacgaacccgaactgacagttcaggaccttgaggacaag
acgccgccgttcgatctcggcacggccttcaagtaccggaccggacagaaggtgtccctc
gccgggcttgagtacggtcagtggtattacgtgtacctcaacaagaccggctaccgcctc
ggctggatgttccccaccactggggacaccgtggagttcatcctcccgcccgaggtcagg
aatggccgggatgacgtggtggtgctggacaaggacggccgccaggtttccttcgaccgg
ctccaagtaacgccgaagggggagaagatctag

DBGET integrated database retrieval system