KEGG   Arthrobacter sp. ZXY-2: ARZXY2_3364Help
Entry
ARZXY2_3364       CDS       T05201                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00290  Valine, leucine and isoleucine biosynthesis
arx00770  Pantothenate and CoA biosynthesis
arx01100  Metabolic pathways
arx01110  Biosynthesis of secondary metabolites
arx01130  Biosynthesis of antibiotics
arx01210  2-Oxocarboxylic acid metabolism
arx01230  Biosynthesis of amino acids
Module
arx_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
arx_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ARZXY2_3364 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ARZXY2_3364 (ilvD)
Enzymes [BR:arx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     ARZXY2_3364 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AOY72878
UniProt: A0A1D9FC04
LinkDB All DBs
Position
complement(3515121..3516983)
Genome map
AA seq 620 aa AA seqDB search
MPALRSKTVTHGRNMAGARALLRASGVANSDIGKPIIAVANSFTEFVPGHTHLAPVGRIV
SDAILAAGAVPREFNTIAVDDGIAMGHSGMLYSLPSRDLIADSVEYMVNAHCADALVCIS
NCDKITPGMLMAALRLNIPVVFVSGGPMEAGRVTLTDGSVRSLDLVNAIADAVDESISDE
DINLIEENACPTCGSCSGMFTANSMNCLAEAIGLALPGNGSVLATHTARKALYEKAGATI
VELVKRYYDGDDDSVLPRNIATAEAFDNAMALDISMGGSTNTILHLLAAAQEAGVNYGLA
EMDAKSRQVPCLAKVAPNVAGNKTYYMEDVHRAGGIPALLGELNRGGLLHKNVHSVHSAD
LDGWLDDWDIRGGKATEEAKALWHAAPGGVRSSTAFSQSNEWTSLDTDAEGGCIRSVEHA
YSKDGGLAVLRGNIAVDGAVVKTAGVDESIWKFEGPAIVCESQDEAVEMILNKTVKEGDV
VVIRYEGPRGGPGMQEMLYPTSFLKGRGLGKKCALITDGRFSGGTSGLSIGHISPEAASG
GDIALVENGDIISIDITQRSLQLQVSEEILAERREKLLVNGGFKPKNRDRQVSPALRAYA
AMALSADKGAVRDVSLVENL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcacttcgttcaaagacagttacccatggccgcaatatggctggagcccgcgca
ctgctgcgtgcctccggcgtcgccaactcggatatcggaaagccgatcatcgccgtggcc
aactccttcactgagttcgttccgggtcacacccacctcgcccccgtgggccgcatcgtc
tctgatgcgatcctcgccgccggcgcagtaccccgcgaattcaacaccatcgccgtggac
gacggcatcgcgatgggccactcaggcatgctctactccctgccgtcccgcgacctgatt
gccgactccgtggagtacatggtcaacgcgcactgcgccgacgccctggtctgtatctcc
aactgcgacaagatcaccccgggtatgctcatggcagcattgcgcctgaacatccctgtt
gtcttcgtgtccggtggccccatggaggccggccgcgtgaccctgaccgacggttccgtg
cgctccctggacctggtgaacgccatcgccgacgccgttgatgagtccatctccgatgaa
gacatcaacctcatcgaggaaaacgcctgccccacgtgcggctcctgctccggtatgttc
acggccaactccatgaactgcctcgccgaggcaatcgggcttgccttgcccggcaacggc
tccgtgctcgccacacacacagcccgcaaagccctttacgagaaggccggtgccacgatc
gtcgagctcgtgaagcgctattacgacggcgacgacgactctgtactgccgcgcaacatc
gccaccgccgaggcttttgacaacgccatggccctggatatctccatgggcggctccacc
aacaccatcctccacctcctggccgcagcccaggaagcgggcgtgaactacggcctggcc
gagatggatgccaagtcccgccaggtgccttgcctggccaaggtggccccgaacgttgcc
gggaacaagacctattacatggaagacgtccaccgggccggcggcatccccgctctgctg
ggcgagctgaaccgcggcggtctcctgcacaagaacgtgcactccgtacactccgcagac
ctggatggctggctggatgactgggacatccgcggcggcaaggccaccgaggaggcaaag
gcgctgtggcacgcggcgcccggtggcgtacgctcctccacggcgttctcgcagtcgaac
gaatggacctccctggacactgacgccgagggtggctgcatccgctcggtggaacacgcc
tattccaaggacggcggcctggctgtgctgcgcggcaacattgccgtggacggcgccgtc
gtgaagaccgccggcgtggacgagtccatctggaagttcgaaggaccggcaattgtctgc
gagtcccaggacgaagcagtggagatgatcctgaacaagacggtcaaggaaggcgacgtg
gtggtcatccgctacgaaggcccccgcggcggtccgggcatgcaggaaatgctgtacccg
acgtcgttcctcaagggccgtggcctcggcaagaagtgcgccctcatcaccgacggacgt
ttctcgggcggcacgtccgggctgtcgatcggccacatctccccggaagccgcttccggc
ggcgacatcgccttggtcgagaacggtgacatcatcagcatcgatatcacgcagcgctct
ttgcagctgcaggtgtccgaggagatcctcgccgaacgccgcgaaaagctgctggtcaac
ggaggcttcaagcccaagaaccgggaccgccaggtatccccggccctgcgtgcctacgcc
gcgatggctctgtccgcggacaagggcgcagtgcgcgacgtctcgctggtggaaaacctc
tag

DBGET integrated database retrieval system