KEGG   Arthrobacter sp. ZXY-2: ARZXY2_420Help
Entry
ARZXY2_420        CDS       T05201                                 

Gene name
bgaB
Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ARZXY2_420 (bgaB)
Enzymes [BR:arx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ARZXY2_420 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Cellulase Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AOY69986
UniProt: A0A1D9F3N7
LinkDB All DBs
Position
complement(437004..439022)
Genome map
AA seq 672 aa AA seqDB search
MLSPETPRGPSVWSSVPGLGYGGDYNPEQWPEHVRLEDIDLMKEAGVNLLSVAIFSWGLL
EPSEGNYDFAWLDDVLDNLHGAGIKVALATATASPPAWLARKHPEILPVTAEGTRLERGS
RRHYSPSSSVYRRYATTMTRVIAERYKDHPALALWHVDNELGCHVGEFYGEEDAAAFRLW
LERRYGSIDALNEAWGTAFWSQHYASFDEIIPPGLAPTTLNPGQQLDFARFNSRAFMDYY
RELLAVLREVTPDVPATTNFMVASATKTLDYFDWAKDMDVIANDHYLVAADPEREIELAF
SADLTRGVAGGNPWILMEHSTSAVNWQPYNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SKAGSEKFHSAMVPHGGRNTQVWRNVVDLGDALRRLEPVKGSRVDSHVAIVFDYEAWWAS
ELDSHPSQGVKYLDTMRAFHRALYLRGVTVDFVHPSADLGGYDLILVCTLYSVTDEAAGS
VAAAASDGATVLISYFSGIVDERDHIRLGGYPGAFRELLGIRTEEFHPLFPGTPVTLSDG
TAGSVWSEQVQALEATEVLSTFTHYPLEGVPAVTRRATGAGSAWYLATLPDADGVDALTA
RLLEEAKVTSAAEASAAVELVRRRSADGRNFLFAINHSREDVAVKSDGVELLGGQRFTGV
VPAGAVAVIAED
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
ttgctttcacctgaaacaccacgcggtccgtccgtttggagcagcgtccccgggcttggg
tacggcggtgactacaaccccgaacagtggcccgaacacgtccggctcgaagacatcgat
ctgatgaaagaggccggcgtcaacctgctgagcgttgccatcttttcctggggcctcctt
gagccaagcgaaggcaattacgacttcgcgtggcttgatgatgtcctggacaatctccac
ggcgcgggcatcaaggttgccctggccaccgccaccgcttctcccccggcatggcttgcc
cgcaagcatcccgaaatccttcccgtcactgcggaaggaacccggctggaacggggctcg
cgacggcactactcgccgtcgtcgtcggtgtaccgccggtacgccacaaccatgacgcgg
gtcatcgccgaacgctacaaggaccacccggcgctggcactgtggcacgtcgacaacgaa
ctcggctgccacgtcggcgagttctacggcgaggaggatgcagccgctttccgcctgtgg
cttgagcgccgctacggcagcattgatgcgttgaacgaagcgtggggcacagccttctgg
tcccagcactatgcatccttcgacgagatcatcccgccgggcttggcccccaccacgctc
aacccgggccagcagctggacttcgcacgcttcaactcccgggccttcatggactactac
cgcgagctgctggcagtactgcgcgaggtcacccccgatgtcccggcaaccaccaacttc
atggtcgccagcgcaaccaaaaccctggactacttcgactgggccaaggacatggatgtc
atcgccaacgaccactacctggtggccgccgatcccgaacgggaaatcgaactcgccttc
agcgccgacctgacccgcggcgtcgccggcggcaacccatggatcctcatggaacattcg
acgtcggccgtgaactggcagccttacaaccaacccaagatgcccggcgaaatgctgcgc
aactcactggcccacgtcgcgcgcggagcggacgccgtcatgttcttccaatggcgccaa
agcaaggccggttcggagaaattccactcggccatggtgccgcacggcggccgcaacacc
caggtctggcgcaacgtggtggacctcggggacgccctgcgcagactggagccggtcaag
ggttcgcgcgttgattcgcacgttgccatcgtcttcgattacgaggcctggtgggcttcc
gagctcgactcgcaccccagccaaggcgtcaaatacctggacacaatgcgggcattccac
cgcgccctgtacctccgcggcgtgaccgtcgactttgtccacccctccgcggacctgggc
ggttacgacctcatcctcgtttgcacgctgtactcggttacggacgaagccgccgggtcc
gtcgccgccgcagcaagcgacggagcaaccgtcctcatcagctacttcagcgggatcgtg
gacgaacgcgatcacatccggttgggcggctacccgggcgcgttccgggaactgctggga
atccggaccgaggagttccacccgctcttccccggcacgccggtgaccttgagcgatgga
actgccggctcggtgtggagcgaacaggtacaggcgctcgaagccaccgaggtcctttcc
acgttcacgcactacccgctcgagggcgtacctgccgtgacacgccgggccacgggcgcc
ggctcggcgtggtacctcgcgaccctcccggatgcggacggcgtcgatgcactcaccgcg
cgcttgctggaggaggcaaaggtgacctcggcagcggaagcttctgccgccgtcgagctt
gtccgccgccgctccgcggacggccgcaacttcctgttcgccatcaaccacagccgggag
gacgtggcggtgaagtccgacggcgtggagctgctgggcggccagcgcttcacgggcgtt
gtgcctgccggagccgtggctgtcattgccgaagactga

DBGET integrated database retrieval system