KEGG   Arthrobacter sp. ZXY-2: ARZXY2_4228Help
Entry
ARZXY2_4228       CDS       T05201                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
Organism
arx  Arthrobacter sp. ZXY-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AOY73728
UniProt: A0A1D9FEA4
LinkDB All DBs
Position
4396082..4397134
Genome map
AA seq 350 aa AA seqDB search
MPPVSPMLAKSVPNIPEVGHYEPKWDGFRTIVFRDGDDVILGSRNEKPMTRYFPELVEAL
KKNLPEKCVVDGEIILISGNRLDFEGLQQRIHPADSRVRMLAEKTPSSFVGFDLLALGDE
DLTARPFSERRAALEKALADAEPPVYVTPAVTDLERAQEWFVQLEGAGLDGVLSKPLDGT
YQPNKRVMFKTKHERTADCVVAGFRWHKTADVVGSMLLGLYDDSGKLHHVGVVAAFPMAK
RKAMVAELEPYQVEIADHPWGEWASQETGAAVGSRMPGAQSRWSAGRDFSFVPLRPELVI
EVAYDYMEGDRFRHTTQFRRWRPDRTPESCTYSQLEEPADYNLGEILKLQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgtttcgcccatgctcgccaaatccgtgcccaacattcccgaggttgggcac
tacgaacccaaatgggacgggttccggaccatcgtcttcagggacggggatgacgtcatc
ctgggcagccgcaacgagaaacccatgacccggtacttccccgagctggtggaggcgttg
aagaagaacctgccggagaagtgcgtggtggatggcgagatcatccttatttccggcaac
cggctcgacttcgaaggactgcagcagcgcatccaccccgccgacagccgcgtccggatg
cttgcagagaagacgccgtcctccttcgtcgggttcgacctcctggcactcggcgacgaa
gacctcactgcccggccgttctccgagcgccgtgctgcgctggaaaaggcgctcgccgat
gccgagccgcccgtgtacgtgacgcctgcggtcaccgaccttgagcgggcacaggaatgg
ttcgtgcagcttgagggagcagggctcgacggcgtgctgtccaaaccgcttgatggcacc
taccagccgaacaagcgggtgatgttcaagaccaagcatgaacggacggcggactgcgtg
gtggccggtttccgttggcacaagacggcggacgtcgtagggtcgatgctgctggggctc
tatgacgattccggcaaactccaccacgttggagtggtggccgccttccccatggcgaag
cggaaggcgatggtggccgagttggagccgtaccaagtggagatcgcggaccatccctgg
ggagagtgggccagccaggaaaccggagcagcggttggttcgaggatgccgggggcccaa
agccgctggagtgccggcagggacttttcttttgttcctctgcggcccgagctcgtgatc
gaagtggcgtacgactacatggaaggagaccggttccggcacaccacgcaattccgcagg
tggcggccggaccggactcctgaaagctgcacgtactcacagctggaggagccggccgac
tataacctcggcgagatcctcaagctgcagtag

DBGET integrated database retrieval system