KEGG   Arthrobacter sp. ZXY-2: ARZXY2_4560
Entry
ARZXY2_4560       CDS       T05201                                 

Definition
(GenBank) putative endopeptidase
  KO
K19188  2,6-dihydroxypseudooxynicotine hydrolase [EC:3.7.1.19]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00760  Nicotinate and nicotinamide metabolism
arx01100  Metabolic pathways
arx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ARZXY2_4560
Enzymes [BR:arx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.19  2,6-dihydroxypseudooxynicotine hydrolase
     ARZXY2_4560
SSDB
Motif
Pfam: DUF1100 Peptidase_S9 Hydrolase_4 DLH Peptidase_S15 Abhydrolase_1 BAAT_C Esterase UPF0227 AXE1
Other DBs
NCBI-ProteinID: AOY74059
UniProt: A0A1D9FF93
LinkDB
Position
pZXY21:complement(187751..188854)
AA seq 367 aa
MTVTSQVKPEDEMLNWGRLILDGVSYSDMVGARDRPKEITWFDYWMSLANEYEQEAERKV
ALGHDLSAGELLMSAALCAQYAQFLWFDERRQKGQARKVELYQKAAPLLSPPAERHELVV
DGIPMPVYVRIPEGPGPHPAVIMLGGLESTKEESFQMENLVLDRGMATATFDGPGQGEMF
EYKRIAGDYEKYTSAVVDLLTKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWG
GFSDLDYWDLETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHD
EVPLSFVDTVLELVPAEHLNLVVEKDGDHCCHNLGIRPRLEMADWLYDVLVAGKKVAPTM
KGWPLNG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgactgtaacttcgcaggtgaaacctgaagatgaaatgctgaactgggggcgtcttatc
cttgacggcgtttcctactcagacatggtgggtgctcgcgataggcccaaggaaatcacc
tggtttgactactggatgagtctcgcaaatgagtatgagcaggaagcggaaaggaaagtg
gcactgggccatgacctgtccgccggtgaactcctgatgtcagccgcactctgtgcccag
tacgcacagttcctctggttcgacgagcgccggcagaagggccaagctcggaaagttgag
ctgtatcagaaggcagctccactgttgtccccgcctgcagagcgtcacgagctagtcgtc
gacggtatcccgatgcccgtctatgtgcgcattccggagggaccgggaccacaccccgct
gtgatcatgcttggtggtcttgagagcacaaaagaggaaagtttccagatggaaaatctt
gtgctcgatcggggaatggctactgccacatttgacggtcccggccagggcgagatgttt
gagtacaagcggattgcgggtgattacgaaaagtacacgtccgcggtagtggatctgctc
accaaacttgaagcgattcggaatgatgctatcggagtgctggggcggagcctgggcggt
aattacgctctcaaatctgccgcctgtgaaccgcgtttggccgcatgcatttcttggggc
ggattctcagacctggactactgggacctcgaaactcccctgacaaaggaaagctggaag
tacgtctccaaggttgacactttggaggaagcaaggctgcacgtccatgcggctttggag
acccgggacgtcctttcccagatcgcatgcccgacgtacatcctgcacggggtgcacgac
gaggttccactgtccttcgtggataccgtcctcgaattggtgccggcagaacacctgaac
ctagtggttgaaaaggacggtgatcactgctgccacaaccttggaatccgtccccggctt
gaaatggcagactggctctatgatgttctggttgccggaaagaaggtcgccccaacaatg
aaagggtggcccctcaatggataa

DBGET integrated database retrieval system