KEGG   Arthrobacter sp. ZXY-2: ARZXY2_699Help
Entry
ARZXY2_699        CDS       T05201                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00010  Glycolysis / Gluconeogenesis
arx00030  Pentose phosphate pathway
arx00051  Fructose and mannose metabolism
arx00052  Galactose metabolism
arx00680  Methane metabolism
arx01100  Metabolic pathways
arx01110  Biosynthesis of secondary metabolites
arx01120  Microbial metabolism in diverse environments
arx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARZXY2_699 (pfkA)
   00030 Pentose phosphate pathway
    ARZXY2_699 (pfkA)
   00051 Fructose and mannose metabolism
    ARZXY2_699 (pfkA)
   00052 Galactose metabolism
    ARZXY2_699 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    ARZXY2_699 (pfkA)
Enzymes [BR:arx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARZXY2_699 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ARZXY2_699 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AOY70262
UniProt: A0A1D9F4U8
LinkDB All DBs
Position
complement(731036..732061)
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGQEFVGFRDGWRGVVEGDVIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPEVIKAHMERLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVEIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHS
GMASGAHAILIPEQKVSIEQIAEWVQLAHDRGRAPLVVVAEGFVPDHMESPHSERGLDTF
GRPRLGGIADQLAPELEARTGIETRATILGHIQRGGVPTAYDRVLATRLGMAAIDSVVDG
RWGTMVALKGTDISHVGFEEALGKLKTVPQHRYDEASVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcattcttaccagcggcggcgactgccccggcctcaacgcagtgatccgt
ggagcggtcctcaaaggcatcgcaatccacggccaggagttcgtgggcttccgggacggc
tggcgtggtgtggtggaaggtgacgtcattgacatcccccgcaccatggtccgcggtatc
gccaagcagggcggcaccatcctgggcacttcccgcaccaaccccttcgagaacggcggc
ggtccggaggtcatcaaggcccacatggaacggctgggcatcgatgccatcatcgcgatc
ggcggcgagggcaccctggcagcagccaaacgcctcactgacgccggtttgaagatcgtc
ggcgtcccgaagaccgtggataacgatctcgacgcgacggactacacctttggtttcgac
actgccgtggaaatcgccacggaggcgatcgaccgcctgcgcaccacgggtgaatcccac
caccgctgcatgattgcggaagtgatgggccgccacgttggctggattgccctccactcc
ggcatggcgtccggcgcccacgccatccttatccccgaacagaaggtgagcatcgaacag
atcgccgagtgggtccaactggcccatgaccgcggtcgcgcacctttggtggtggtggcg
gaagggttcgtgcccgatcacatggaatccccgcactccgaacgcggcctggataccttt
ggccgtccccggctgggaggcatcgcggaccagctggcacccgagctcgaggcgcgcacg
ggcatcgagacccgtgcgaccatcctcggccacatccagcgcggcggcgttcccaccgct
tatgaccgcgtcctcgccacgcgcctgggcatggcagcgatcgactccgtggtggacggc
cgctggggaaccatggttgcgctcaagggcacggacatctcccatgttggttttgaggaa
gccctcggcaagctcaagaccgtgccgcagcaccgctacgacgaagcgtcagtgttgttt
ggttag

DBGET integrated database retrieval system