KEGG   Arthrobacter sp. ZXY-2: ARZXY2_815Help
Entry
ARZXY2_815        CDS       T05201                                 

Gene name
glpA
Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00564  Glycerophospholipid metabolism
arx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARZXY2_815 (glpA)
Enzymes [BR:arx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ARZXY2_815 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DnaG_DnaB_bind AlaDh_PNT_C SRP_SPB Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOY70377
UniProt: A0A1D9F4Q8
LinkDB All DBs
Position
849270..851024
Genome map
AA seq 584 aa AA seqDB search
MSNIAGGSQVNSAGALSPESRAVSIEALKATAEAGKELDILIVGGGVVGAGAALDAVTRG
LTVGIVEARDWSSGTSSRSSKLIHGGLRYLEMLDFALVQEALQERGLLIQTIAPHLVRPV
PFLYPLTRRFVERPYVGAGIMLYDTLGLTSGHSRGVPMHRHLTKRGTLRAAPSLKDDAFV
GSIRYYDAQVDDARLVVNVVRTAAHYGAHAANRLRVVDFLREGERVVGAKLENQEDGEVF
EVRAKQVVNATGVWTDETQAMVTDRGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVL
FVIPWGRHWIIGTTDTDWTLDKAHPAASSKDIDYVLEHVNRVLKRPLTREDVEGVYAGLR
PLLAGDNDSTAKLSREHVVAHPVPGLVVVAGGKYTTYRVMAKDAVDEATRAMDERVPPSC
TDTIPLLGAEGFKAAWNRRARSAEEAGVHVARVEHLLNRYGSMTAEVLDLIARQPELAEP
LPGADDYLAAEVVYATTHEGARHVHDVLTRRTRISIEAWDRGVSAVPVVAKLMGEILGWS
DTQRESEIKHYLARVEAERLSQEQPDDESADAARMGVDDIMPLR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgcaggcggttcgcaggtgaattctgcgggagccctgagtcccgagtcc
cgtgccgtatccattgaagcgttgaaggccactgccgaggcaggcaaggaactggacatc
ctgattgtcggcggaggcgtcgtgggcgccggcgccgcgcttgatgcagtgacccgtggc
ttgacggtgggcatcgtcgaggcgcgcgactggtcctcgggcacgtcgtcgcgatcctcc
aaactcatccacggcggcttgcggtaccttgagatgctggatttcgccttggtgcaggaa
gcgctccaggaacgcgggctcctgatccagaccattgcaccgcacttggtccgccccgtg
ccgttcctgtacccgctgacgcggcgcttcgtcgagcggccctacgtcggcgccggcatc
atgctctatgacaccctgggcctcacctccggccacagccgtggcgtgccgatgcaccgg
cacctcaccaagcgcggcactcttcgtgcagctcccagcctcaaggacgacgcgttcgtg
ggatccatccgctattacgacgcgcaggtggatgacgcgcgattggtggtcaacgtcgtc
cggaccgccgcgcactacggagcccatgctgccaaccggctacgcgtggtggacttcctc
cgcgagggtgagcgcgtggtcggcgccaagcttgagaaccaggaggacggcgaggttttc
gaagtccgggccaagcaagtggtcaatgccacgggcgtctggacggacgagacccaggcc
atggtcaccgatcgcggccagctcaaggtccgggcatccaaggggatccacctggtggtt
ccccgcgaccgtttccaatcaaccgtgggtctcatcctgcgcacggaaaagtcggtcctt
ttcgttatcccctggggtcgccactggatcatcggcaccactgacactgactggacgctg
gataaagcgcaccccgcagcttccagcaaggacatcgattacgtcctggagcacgtcaac
cgtgtgctgaagcgcccgttgacccgtgaggatgtggagggcgtctatgccgggctccgg
ccgctcctcgccggggacaacgactcgacggccaagttgtcgcgggagcacgtcgtggcg
catccggttccagggctcgtggtggttgccggcggtaagtacaccacgtaccgggtcatg
gccaaggacgccgtggacgaggccacccgggccatggacgagcgggtcccgccaagctgc
acggataccattccgctgctcggagccgaaggcttcaaggcagcgtggaaccggcgcgca
cgttcagcggaggaagccggagtccacgtggcacgggtggagcacctgctgaaccgttac
ggctccatgacagccgaggtactggatctcattgcgcggcaaccggaattggcggagccg
ctgcccggtgcggacgattacctggcagccgaagtggtctacgcaaccacccacgaaggc
gcacgacatgtacacgatgtcctgacgcgccggacccggatatccatcgaagcctgggac
cggggtgtgtccgccgttccggtagtcgctaagctgatgggagaaatcctcggctggagc
gacacccagcgcgaaagcgaaatcaagcattacttggcaagggtggaagccgaaaggctc
agccaggagcagccggacgacgagtcagcggatgcggcccgcatgggagtcgatgacatc
atgccccttcgctga

DBGET integrated database retrieval system