KEGG   Arthrobacter sp. YC-RL1: ATC04_01630Help
Entry
ATC04_01630       CDS       T04187                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    ATC04_01630
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ATC04_01630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ary02042]
    ATC04_01630
Enzymes [BR:ary01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ATC04_01630
Bacterial toxins [BR:ary02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ATC04_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 ChitinaseA_N BNR Sortilin-Vps10 DUF11 AbrB-like Alpha_adaptinC2
Motif
Other DBs
NCBI-ProteinID: ALQ29368
UniProt: A0A0S2YT40
LinkDB All DBs
Position
351000..353867
Genome map
AA seq 955 aa AA seqDB search
MKFPDRHRRRSIALAVAVSLAVPLSLMPAANAAGSLSDADPTAAPGQFAEANLAQDRTDA
NFFYRIPALVHLGDGVVLASWDARPGSAADAPNPNSIVQRRSVDNGKSWGPMTTVAAGFP
GSATEGKYGYSDPSYVFDEESGKVFNFFVYSKDQGFHGSTWGHDDGNRQVISAAVVESTD
GGETWSAPRLITDVAKPGDGPVPGAVRSTFATSGAGIQVTRGDYKGRLIQQYAGDVVQAN
GSQTYQAYSVYSDDHGATWQRGEFTGTSMDENKVVELSDGRIMLNSRDSAGGGFRKVAIS
EDGGHSYSAVVQDRQLPDPTNNAHLTKMFPEAQAGSDDARKLLYTGANSQTGRENVSARV
SCDDGKTWPGLRTIRRGFSAYSVATAMDDGRYGVFYEGSYTNSMDFASIDEDWLNYVCAP
MSAPKFTADAGQTAAMDVTITNQENHPVGGTLQVQGNSQVSSGQLSIDPIPAKEQRTVQL
PVTATAVANGRQQLQLQFTDSSGKMSQALVDAEITGKEVTGLDIKGQRADAGRDLAASPY
QTGEKLPYTFTVKNAGNVNQWVVPTEGNFAPFAARPVGQPSDAGNCRYSNLAAGASYSCA
TPRHTVTEADLSDGFFVPKTTWTAGKLNDYTTVLNDYVITADEVDVLERRPALAAEAADP
VVNDLDADGYASAGDTVTYTASVHNNGNVRLTSLHGASWEAQELAAGERATVEITRTLST
SDIEAGLLEAGTETLEGANGLRLATAELKLPALQLNVAPKDDATVKPGKAVLSDDNGHDT
GLKDGDFTVTMNLWSGSNASQFILLEGGREIARKNLVPASPAAQQARVGIEGRKNGTYEY
QGVLVNAAGSTKTAVLKVKVTDANPGTPVLSAKAGSSRGELTLTTDMWWGTNATSYQLFE
NGKLVDSQELVAATPAAQRVVTVLSDRKPGTYEYQVKLGNDAGESSSKIRSVRVK
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcctgatcgtcatcgccgccgatccattgccctggccgtggcagtctcgttg
gcggtaccgctgtcgctgatgcccgccgccaatgccgcgggatcgctcagcgacgcagac
cctaccgcggcgcccggccagttcgccgaggccaacctcgcgcaggatcgcaccgacgcg
aacttcttctaccgcatccccgccctggtccacctgggtgacggcgtcgtgctggcctcc
tgggacgcgcgcccgggcagcgcggccgatgcgcccaaccccaactccatcgtccagcgc
cgcagcgtcgacaatggcaagtcctggggtcccatgaccaccgtggccgctggcttcccc
ggcagcgccaccgaaggcaaatacggctactcggatccgagctacgtgttcgacgaggaa
tccggcaaggtcttcaacttcttcgtctactccaaggaccagggcttccacggcagcacc
tggggccatgatgacggcaatcgtcaggtgatcagcgcagccgtggtcgaatccacggac
ggcggcgagacctggagcgctccgcggttgatcaccgacgtggccaaaccaggggatggg
ccggtgcccggcgcggtgcgcagcaccttcgccacctcgggcgccggcatccaggtcacc
cgcggagactacaagggccggctgatccagcagtacgccggcgacgtggtgcaggccaac
ggctcgcagacctaccaggcgtactccgtgtactcggacgaccacggggccacctggcag
cgcggcgagttcaccggaacctccatggacgaaaacaaggttgtcgagctctccgacggc
aggatcatgctcaactcgcgggactcggcgggcggcggcttccgcaaggtcgccatctcc
gaggacggcgggcacagctactccgccgtggtccaggaccgccagctgccggatccgacc
aacaacgcgcacctgaccaagatgttcccggaggcccaggccggcagcgacgacgccagg
aaactgctgtacaccggcgccaactcgcagaccggccgcgaaaacgtctcggcccgggtg
tcctgcgacgacggcaagacctggccgggactgcgcaccatccggcgcggattctccgcc
tattcggtggcaaccgccatggatgacggccggtacggcgtcttctacgagggcagctac
accaactccatggacttcgcctccatcgacgaggactggctgaactacgtgtgcgctccg
atgtccgccccgaagttcaccgccgacgccggacagactgccgccatggacgtcacgatc
accaaccaggaaaaccacccggtgggcggcaccctgcaggtgcagggcaacagccaggtc
tcctccgggcagctgtccatcgacccgatcccggccaaggagcagcgcacggtccagctt
ccggtcaccgccaccgcggtggccaacggacgccagcagctgcagctgcagttcaccgac
tccagcggcaagatgtcccaggccctcgtggacgcggagatcaccggcaaggaagtgacc
ggcctggacatcaagggccaacgcgccgatgcaggccgcgacctcgccgcgtccccgtac
cagacgggggagaagctgccgtacacgttcaccgtgaagaatgccggcaacgtcaaccag
tgggtggtcccgaccgagggcaacttcgcgccgttcgcggcccggcccgtcgggcagccg
agcgatgcgggcaactgccgctactcgaatctcgcggccggcgcgtcctacagttgcgcc
accccgcgccacacggtgaccgaggccgacctctccgacggcttcttcgtcccgaagacc
acgtggaccgccggcaagctcaacgactacaccacggtgctcaacgactacgtgatcacc
gcagacgaggtcgacgtgctggaacggcgcccggcgctggccgccgaggccgccgacccg
gtggtcaacgacctggacgccgacggctacgcgtctgccggcgacaccgtcacctacacg
gcgagcgtgcacaacaacggcaacgtccggctgaccagcctgcatggcgccagctgggag
gctcaggagcttgccgcaggcgagcgcgccacggtggagattacccgtacgctgagcacc
tcggatatcgaagcgggcttgctggaagccggaaccgaaaccctggaaggagccaacggc
ttgcgcctggccacggcggagctgaagctgcccgcgctgcagctgaacgtggcaccgaag
gacgacgcgaccgtcaagcctggcaaggccgtgctgtccgatgacaacgggcacgacacc
ggcctgaaggacggcgatttcaccgtcaccatgaacctgtggtccgggtccaacgcctcg
cagttcatcctgttggaaggcggccgggagatcgcccgcaagaacctggttcccgcctct
cctgcggcgcagcaggcccgggtggggatcgaaggtaggaagaacggcacctacgaatac
cagggtgtgctggtgaatgcggcaggaagcaccaagaccgcggtgctcaaggtcaaggtc
acggacgcgaaccccggcaccccggtgctcagcgccaaggcgggatcctcgcgaggggag
ctgacgctgaccaccgacatgtggtggggcaccaatgccacgagctaccagctgttcgag
aacggaaagctggtcgactcgcaggaactggtcgccgcaacccccgcggcccagcgtgtg
gtgaccgttctcagcgaccgcaagcccgggacctacgagtatcaggtgaagctgggtaat
gacgccggcgaatcgagcagcaagattcgcagcgtgcgcgtgaagtag

DBGET integrated database retrieval system