KEGG   Arthrobacter sp. YC-RL1: ATC04_06495Help
Entry
ATC04_06495       CDS       T04187                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00220  Arginine biosynthesis
ary00250  Alanine, aspartate and glutamate metabolism
ary00290  Valine, leucine and isoleucine biosynthesis
ary01100  Metabolic pathways
ary01110  Biosynthesis of secondary metabolites
ary01130  Biosynthesis of antibiotics
ary01210  2-Oxocarboxylic acid metabolism
ary01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ary00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ATC04_06495
   00290 Valine, leucine and isoleucine biosynthesis
    ATC04_06495
   00220 Arginine biosynthesis
    ATC04_06495
Enzymes [BR:ary01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ATC04_06495
    2.6.1.66  valine---pyruvate transaminase
     ATC04_06495
Amino acid related enzymes [BR:ary01007]
 Aminotransferase (transaminase)
  Class I
   ATC04_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Costars
Motif
Other DBs
NCBI-ProteinID: ALQ30249
UniProt: A0A0H0ZNS1
LinkDB All DBs
Position
1382888..1384108
Genome map
AA seq 406 aa AA seqDB search
MAEFKQSTKLHNVLYDIRGPLLEHATRMEAEGHRILKLNIGNPAPFGFEAPDAVLVDMIR
NLPNAQGYSDSRGILSARTAVSQYYQTRGIQTIGVDDIYLGNGVSELITLSLNALLNNGD
EVLIPAPDYPLWTASVSLAGGTPVHYLNVEEEGWLPDLEDMEAKITDRTKGIVIINPNNP
TGAVYPKETLEGILELARKHDLIVFSDEIYEKILYDDAEHINTAGLADDVLVITFSGLSK
AYRVCGFRAGWMAISGPRHLAADYIEGINLLTNMRLCANVPAQHAIQTALGGYQSINDLI
LPGGRLLEQRDAAYNLLTAIPGVSVQKAKGALYMFPKLDPEVYPIHDDEKFALELLKAQK
ILISQGTAFNWVRPDHFRLVTLPNVRDLTDAVGRIGTFLEDWRARA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcaaacaatcgacgaaactgcacaacgtcctctacgacatccgcgggccg
ctgctggagcacgccacccgcatggaggccgagggccaccgcatcctgaagctgaacatc
ggcaatcccgcgccgttcggcttcgaggcgcccgacgcggtgctcgtcgacatgattcgc
aacctgcccaacgcccagggctactccgactcgcgcggcatcctctccgcccggaccgcg
gtctcgcagtactaccagacccgcggcatccagaccatcggcgtggacgacatctacctg
ggcaacggcgtctccgagctgatcaccctgagcctgaacgcgctgcttaacaacggcgac
gaggtgctgatcccggctcccgactacccgttgtggaccgcctcggtctcgctggccggc
ggcaccccggtgcactacctcaacgtggaggaggagggctggcttccggacctggaggac
atggaagcgaagatcaccgaccgcaccaagggcatcgtgatcatcaacccgaacaacccc
accggcgccgtctacccgaaggagaccctggaggggatcctggaactggcccgcaagcac
gatctgatcgtcttctccgacgagatctacgagaagatcctctacgacgacgccgagcac
atcaacaccgccggcctggccgacgacgtgctggtcatcaccttctccgggctgtccaag
gcctaccgggtctgcggcttccgcgccggctggatggccatttccggtccgcgccacctg
gcagcggactacatcgagggcatcaacctgctgaccaacatgcgcctgtgcgccaatgtg
ccggcgcagcatgcaatccagaccgcgctgggcggctaccagtcgatcaacgacctgatc
ctgcccggcggccgcctgctggagcagcgcgacgcggcctacaacctgctcaccgccatc
cccggcgtgagcgtgcagaaggccaagggcgcgctgtacatgttcccgaagctggatccc
gaggtctacccgatccacgacgacgagaagttcgccctggagctgctcaaggcgcagaag
atcctgatctcccagggcaccgcgttcaactgggtgcgccctgaccacttccgcctggtc
acgcttccgaacgtgcgcgacctgactgatgcggtcggccgcatcggtactttccttgag
gactggcgcgcccgcgcataa

DBGET integrated database retrieval system