KEGG   Arthrobacter sp. YC-RL1: ATC04_08780Help
Entry
ATC04_08780       CDS       T04187                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00020  Citrate cycle (TCA cycle)
ary00190  Oxidative phosphorylation
ary00650  Butanoate metabolism
ary01100  Metabolic pathways
ary01110  Biosynthesis of secondary metabolites
ary01120  Microbial metabolism in diverse environments
ary01130  Biosynthesis of antibiotics
ary01200  Carbon metabolism
Module
ary_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ary_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ary_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATC04_08780
   00650 Butanoate metabolism
    ATC04_08780
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ATC04_08780
Enzymes [BR:ary01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ATC04_08780
    1.3.5.4  fumarate reductase (quinol)
     ATC04_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 HI0933_like DAO Thi4 Pyr_redox_3 NAD_binding_8 GIDA Pyr_redox ApbA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ALQ32354
UniProt: A0A0H0ZRV6
LinkDB All DBs
Position
1873924..1875651
Genome map
AA seq 575 aa AA seqDB search
MKPEQQISTSVLVIGTGGSGLRAAIELAEQGVDVLAVGKRPRHDAHTSLAAGGINAALGT
MDEEDSWQQHAADTIKESYFLADPRTVQVVAQGAARGIEDLERYGMNFAREVDGRISQRF
FGAHTFRRTAFAGDYTGLEIQRTLIKRAEQLQVPILDTVYITELLTAEGQIFGAYGFDVN
HGTGYLIHADAVILAAGGHNRIWRRSSSRRDENTGDSFRLAVQAGARLRDPELVQFHPSG
IIEPESDAGTLVSEAARGEGGILTNALGERFMARYDAKRMELSTRDRVALAAYTEIREGR
GTENGGVWLDVSHLDREVIMKRLPRVYQTMMELQMLDITSQKMEIAPTAHYSMGGVWVDP
LTHATEVPGLYAIGEASSGLHGANRLGGNSLIELLVFGRIVGQHAAQYSASLASQPRSAR
AIAAARAHIAELLGSRGQENVRSLQRAIRDLMTEHAGVVRDEAGLLEGLAKLQAIEQRMA
NVGIHPDIAGYQDLAHAFDLQSSALAARATLEAALERRETRGCHNRSDYPAMDPELQVNL
VWSPSTGITREPISEVPAQIAELITEVSQEGKLVE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagaacagcagatatccacgtcagtcctcgtcatcggcaccggaggatccggc
ctgcgcgccgcgatcgaattggccgagcagggcgtcgacgtgttggcggtgggcaagcgc
ccgcgccacgacgcgcacacctccctggccgccggcggcatcaatgcggcgctgggcact
atggacgaggaagacagctggcagcagcacgcggccgacaccatcaaggaaagctacttc
ctggccgacccgcgcaccgtgcaggtggtcgcccagggcgccgcccgcggcatcgaggac
cttgaacgctacgggatgaacttcgcccgcgaggtggacggccgcatctcgcagcgcttc
ttcggcgcccacaccttccgccgtaccgccttcgccggggactacaccggcctggagatc
cagcgcacgctgatcaagcgggccgagcagctgcaggtgccgatcctcgacaccgtgtac
atcaccgagctgctcaccgccgaagggcagatcttcggagcctacggcttcgacgtcaac
cacggcaccggctatctcatccacgccgatgcggtgatcctggccgccggcgggcacaac
cgcatctggcgccgcagcagctcgcgccgcgatgagaacaccggcgactcgttccgcctg
gccgtccaggccggcgcccggctgcgcgaccccgagctggtgcagttccacccctcgggc
atcatcgaaccggaaagcgacgccggaaccctggtctccgaggccgcgcgcggcgaaggc
ggaatcctgaccaatgcgctgggcgaacgcttcatggcccgctacgacgccaagcgcatg
gagctgtccacccgcgaccgggtcgcgctggccgcctacaccgagatccgcgagggacgc
ggcaccgagaacggcggggtgtggctggacgtctcgcaccttgaccgcgaagtcatcatg
aagcgcctgccgcgggtctaccagaccatgatggaactgcagatgctggacatcacctcg
cagaagatggagatcgccccgaccgcgcactactccatgggcggggtctgggtggacccg
ctgacccatgccaccgaagttcccgggctctacgccatcggcgaggcctcctccgggctg
cacggggccaatcggctgggcggcaactcgctgatcgagctgctggtcttcgggcgcatc
gtgggacagcacgcggcgcagtactccgcgtcgctggcctcccagccgcgctcggcgcgg
gccatcgccgccgcccgcgcccacatcgcagagctgctcggatcccgcggccaggaaaac
gtgcgcagcctgcagcgcgccatccgcgacctgatgaccgagcacgccggggtggtgcgc
gacgaggccgggctgctggaaggcctggcgaagcttcaggccatcgagcagcgcatggcc
aacgtgggaatccacccggacatcgccggctaccaggacctggcccacgccttcgacctg
cagtcctcggcgctggccgcccgcgccacgctggaagcagcgctggaacgccgcgaaacc
cgcggctgccacaaccgcagcgactacccggccatggatcctgagctgcaggtgaacctg
gtctggtcgccgagcaccgggatcacccgcgaaccgatttccgaagttccggcgcagatc
gcggaactgatcaccgaggtgtcccaggaaggcaaactcgtggagtaa

DBGET integrated database retrieval system