KEGG   Arthrobacter sp. YC-RL1: ATC04_14485Help
Entry
ATC04_14485       CDS       T04187                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00020  Citrate cycle (TCA cycle)
ary00190  Oxidative phosphorylation
ary00650  Butanoate metabolism
ary01100  Metabolic pathways
ary01110  Biosynthesis of secondary metabolites
ary01120  Microbial metabolism in diverse environments
ary01130  Biosynthesis of antibiotics
ary01200  Carbon metabolism
Module
ary_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ary_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ary_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATC04_14485
   00650 Butanoate metabolism
    ATC04_14485
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ATC04_14485
Enzymes [BR:ary01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ATC04_14485
    1.3.5.4  fumarate reductase (quinol)
     ATC04_14485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_20 Fer4_18 Fer4_4 Fer4_6 Fer4_2 Fer4_15 Fer4_16 Fer4_21
Motif
Other DBs
NCBI-ProteinID: ALQ31641
UniProt: A0A0H0ZS78
LinkDB All DBs
Position
3137472..3138254
Genome map
AA seq 260 aa AA seqDB search
MSTELPEPPSKIELKAGVGGGGEIPTFNITLRVRRYLPETTAEAYWEDFKLTMYGTDRVL
DALHKVKWDHDGSLSFRRSCAHGICGSDAMRINGRNRLACKTLLKDLDTSKPITVEAIKG
LPLEKDLIVDMEPFFQSYREIMPFLISKGHEPTKERYQSVEDRERFDDTTKCILCAACTS
SCPVFWTDGQYFGPAAIVNAHRFIFDSRDDAGDMRLEILNDKEGVWRCRTTFNCTEACPR
GIQVTKAIAEVKQAILSRTV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaactgccagaaccaccatcaaagattgagttgaaggccggtgttggtggc
ggcggagagatccctaccttcaacatcaccctgcgcgttcgccgctacctgccggagacc
acagcagaggcctactgggaagacttcaagctgaccatgtacggcaccgaccgagtgctg
gacgccctgcacaaggtcaagtgggaccacgacggctcgctgtcgttccgccgttcctgc
gcccacggcatttgcggttcggatgccatgcgcatcaacggccgcaaccgcctggcctgc
aagaccctgctgaaggacctggacacctccaagccgatcaccgttgaggcaatcaagggt
cttccgctggagaaggacctgatcgtggacatggaaccgttcttccagtcctaccgcgag
atcatgccgttcctgatttccaagggccacgagccgaccaaggaacgctaccagtcggtc
gaggaccgcgagcgcttcgatgacaccaccaagtgcatcctctgcgccgcctgcacctcc
tcctgcccggtgttctggaccgatggccagtacttcggcccggcagcgatcgtcaatgcg
caccgcttcatcttcgactcgcgcgatgatgcaggcgacatgcgcttggagatcctgaac
gacaaggaaggcgtgtggcgctgccgcaccaccttcaactgcaccgaagcgtgcccacgc
ggcatccaggtgaccaaggctatcgccgaggtcaagcaggcgatcctctcgcgcaccgtc
taa

DBGET integrated database retrieval system