KEGG   Arthrobacter sp. YC-RL1: ATC04_15110Help
Entry
ATC04_15110       CDS       T04187                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ATC04_15110
Enzymes [BR:ary01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ATC04_15110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALQ31748
UniProt: A0A0H0ZSQ6
LinkDB All DBs
Position
complement(3285987..3287453)
Genome map
AA seq 488 aa AA seqDB search
MTLSTSANLLAQLDQYINGVWVQGEGGMITTQSASDSAVVLASGNAASADQIDQAFQAAE
AARKSWAATPMAARGAILVKAAAYLQENSASFGEQLSAEEGKTKAEGVGEVLRAAQILTY
YAAEAERAAGTVYQSPRAGEQIMVTHKPLGVVGVITPFNFPIAIPAWKIAPALVFGNTVV
FKPASLVPLLAVRLVEALAHAGLPAGVLNLVIGPGSLGDAIMEHEHLDALSFTGSTGVGR
RLCAAGAARGIPVQAEMGGKNASVVLADADLDLASEQVLFGAFRSTGQKCTATSRLILDE
SIAEEFLAKLTGRLDSWVTGDPLDPSVHMGPLVDAKAAVSVRAGVDKAIAEGATVAYSGK
APNGGSFMAPTILELPAGPAGRANTAWREEFFAPVLSVVRVNGTEEAFEAAEDSQFGLSL
ALFTRDLSVALAAQQTLDVGILHVNSESAGADPHVPFGGAKASGYGPKEQGAAAREFYTH
TTTVYLRG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccctatcgacctccgcaaacctgctcgcccagctcgaccagtacatcaacggtgtc
tgggtgcagggcgaaggcggcatgatcaccacgcagagcgcctcggactccgccgtggtc
ctggcctccggcaacgccgccagcgcggaccagatcgaccaggcattccaggccgccgaa
gcggcccggaagtcctgggcggccaccccgatggccgcccgcggggcgatcctggtcaag
gcggccgcctacctgcaggagaactccgccagcttcggcgagcagctttccgccgaggaa
ggcaagaccaaggccgaaggcgtgggcgaggtgctgcgcgccgcgcagatcctgacctac
tacgccgcggaggctgagcgcgccgccggcaccgtttaccagtccccgcgcgccggggag
cagatcatggtcacccacaagccgctgggcgtggtcggcgtaatcaccccgttcaacttc
ccgatcgccatcccggcctggaagatcgccccggcgctggtcttcggcaacaccgtggtg
tttaagcctgccagcttggtgccgctgctggcggtgcgcctggtggaggccctggcccac
gccggcctgccggccggcgtgctgaacctggtcatcggaccgggctcgctgggcgatgcg
atcatggagcacgagcaccttgacgcgctgagcttcaccggttccaccggggtgggccgt
cggctgtgcgccgccggcgccgcccgcggcatcccggtgcaggctgaaatgggcgggaag
aacgcctccgtggtgctggctgacgcggacctggacctggccagcgagcaggtgctgttc
ggcgccttccgctccaccggtcagaagtgcaccgccaccagccggctgatcctggacgag
tcgattgccgaggagttcctggccaagctcaccggccgcctggattcctgggtgaccggc
gatccgctggatccttccgtgcacatgggcccgctggtggacgccaaggccgcggtctcg
gtgcgcgccggggtggacaaggcgatcgccgaaggcgccaccgtggcctactccggcaag
gctccgaacggcggtagcttcatggcgccgaccatcctggaactgccggccgggccggcc
ggacgcgcgaacaccgcctggcgcgaggaattcttcgctccggtgctttccgtagtgcgc
gtgaacgggaccgaggaggccttcgaggccgcggaggactctcagttcgggctgagcctg
gcgctgttcacccgcgacctgtctgtggcgctggccgcgcaacagactctcgatgtgggg
attttgcatgtaaattcggaatcagcgggtgccgacccgcacgttccgttcggcggagcc
aaggcctcaggctatggtcccaaggagcagggcgccgccgcgcgcgagttctacacgcac
accaccacggtgtacctgcgcggctag

DBGET integrated database retrieval system