KEGG   Arthrobacter sp. ATCC 21022: AUT26_03340Help
Entry
AUT26_03340       CDS       T04477                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arz  Arthrobacter sp. ATCC 21022
Pathway
arz00620  Pyruvate metabolism
arz00680  Methane metabolism
arz01100  Metabolic pathways
arz01120  Microbial metabolism in diverse environments
arz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AUT26_03340
  09102 Energy metabolism
   00680 Methane metabolism
    AUT26_03340
Enzymes [BR:arz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AUT26_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Se-cys_synth_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMB39360
UniProt: A0A0X4JQK5
LinkDB All DBs
Position
710202..713000
Genome map
AA seq 932 aa AA seqDB search
MVHTAQQSTDLAAELRADVRRVSTLLGESLVRQHGPELLELVEQVRLLTKESKEAARGGA
DATGPWSAHDVVAQVRELLASLPLEQATDLVRAFAFYFHLSNAAEQVHRVRGLRTRQEKD
GWLAKAVSEIAGQAGPEILQDVVNELDVRPIFTAHPTEASRRSVLDKIRKLSDVLAQPTA
EGTSARRRQDRQLAEIIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDAMPEMLTDLS
ELLAEHGVKLPTGAAPLRFGSWIGGDRDGNPNVTAAVTREILQLQNQNAVRISIALIDEL
ISVLSNSTALFGADQELLDSIEVDLKNLPGLDKRVLELNAQEPYRLKLTCIKAKLINTGR
RISASTYHEPGRDYATTSELLAEFGLLETSLRNHAAGLVADGALARVRRALAAFGLHLAT
LDIREHADYHHDAVGQLVDRLGTEKPYGSLTREERLAFLGEELASRRPLSGHPIKLDGAA
DGTYDVFRSIRQALNTYGPDVVETYIISMTRGADDVLAAAVLAREAGLIDLFGANPHARI
GFAPLLETVEELRASAEIVDQLLSDPSYRELVRLRGDIQEIMLGYSDSNKESGVLTSQWE
IHKTQRKLRDVAAKHGVRVRLFHGRGGSVGRGGGPTYDAIMAQPNGVLEGEIKFTEQGEV
ISDKYSLPELARENLELSLAAVMQGSALHRTPRTSEDQRERYGNVMETISDAAFARYRAL
IDDPDLPAYFLASTPVEQLGSLNIGSRPSKRPDSGAGLGGLRAIPWVFGWTQSRQIVPGW
FGVGSGLKKARESGNTEQLMEMMERWHFFRSVISNVEMTLAKTDMEIAGHYVSSLVPQEL
HRLFHMIRDEYELTVAEVERLTGELELLDAQPTLKRSLEIRDQYLDPISYLQVELLRRVR
EESVSGAEIDERLQRAMLITVNGVAAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggttcacactgcccagcaatccactgatctcgccgcggaactgcgagccgacgtccgc
agggtttcaaccctgctgggcgagtcgttggtccggcaacacggtcccgaattgctggaa
ttggtggagcaggtccgcctgctgaccaaggagtccaaggaagcggcgcgtggcggcgcc
gatgccaccggaccgtggagcgcgcacgacgtcgtagcccaggtccgcgaattgctcgcc
tccctgccgctggagcaggcaaccgacttggtccgggctttcgctttctacttccacctc
agcaacgctgccgagcaggtccaccgggtgcgggggctgcggaccaggcaggagaaggac
ggttggctggctaaggccgtttccgaaatcgcgggtcaggcagggccggagatcctgcag
gacgtagtcaacgaactcgatgtccgcccgatcttcaccgcccaccccaccgaggcctcc
aggcgttcggtcctggacaagatccgtaagctttccgatgtgctggcacagcccactgcg
gaaggcacctcggccaggcgccgtcaggaccgccagctcgccgaaatcatcgatcagatg
tggcaaacagacgagctccggcaagtgcggccgactcccgtggatgaagcgcgcaatgcc
atctactacttgaacagcatcctcaccgatgccatgccggagatgctcacggatctttcc
gagctcctggcggaacacggagtcaagctccccacaggcgccgcgcccttgcgcttcggc
tcctggatcggtggtgaccgggacggcaacccgaacgtcacggcggctgttacccgcgag
atcctccagctccaaaaccagaatgcggtccggatcagcattgccctgatcgatgagctg
atttccgtcctttccaactccaccgcactgttcggcgctgaccaggagttgctggactcc
atcgaggtggacctcaagaacctgcccggcctggacaaacgggtgctggagctcaatgcg
caggagccgtacaggctcaagctcacatgcatcaaagccaagctcatcaatacggggcgt
cgcatctcggcgtcgacgtatcacgagccgggccgcgactatgccacgacctccgaactc
ctcgccgaattcggactcctggaaacgtcgctccgcaaccacgccgccgggcttgtggcg
gacggtgccctggcccgtgtcaggagggcgctcgcagcgttcggtctgcatttggccacc
ttggacatccgtgaacatgccgattaccatcacgacgccgtgggtcaactcgtcgacagg
ctagggacggagaagccgtatggctccctcacccgcgaggagcgcctcgcgttcctcggc
gaagagctggcgtcccgccgtcccttgtccggccaccccattaagctcgacggcgccgcc
gacggtacgtacgacgtcttccggagcattcgccaggccctgaatacttacgggccggac
gtcgtggaaacctacatcatttccatgacgcgcggtgccgatgatgtgctggcagccgcc
gtgttggcccgcgaagccgggctcattgacctcttcggggcgaatccgcacgcacggatc
ggtttcgctccgctgcttgagacggtggaagaactgcgtgcttctgcggaaatcgtggac
cagcttttgtctgatccgtcctaccgtgagctcgtccgcctgcgcggggacatccaggaa
atcatgctgggctactcggattccaacaaggaatcgggcgtgctcaccagccagtgggaa
atccacaagacccagcggaagttgcgcgacgtcgctgcgaagcatggtgtccgcgtgcgg
ctcttccacggccgaggtggttcagtggggcgcggcggtggacctacctacgacgccatc
atggcccagcccaacggggtgcttgagggtgagatcaagttcaccgagcaaggcgaggtt
atctcggacaagtactccttgccggagcttgcacgcgaaaacttggaactgtcgctggcg
gcggtgatgcagggctcggccctgcaccgcactccgcgcacgtccgaggaccagcgtgaa
cgctacggcaacgtcatggagaccatttccgacgccgcgttcgcacggtaccgcgccctg
attgacgatcccgaccttccggcctacttcctggcatcgacgcccgtggagcagttgggc
tcgttgaacatcggctcccgcccgtccaagcgtcccgattccggtgcaggcctgggcggc
ttgcgtgcaatcccgtgggtgttcggatggacccagtcccgccagattgttcccggttgg
ttcggcgtcggttcaggcctgaagaaggcccgcgagtccggcaacacggagcagctgatg
gagatgatggagcgctggcacttcttccgttccgtgatctccaacgtcgagatgacgttg
gctaagacggacatggaaattgccgggcactacgtgtcctccttggtgccgcaggaactc
caccggctcttccacatgatccgggacgagtacgaactgacggtcgccgaggtcgagagg
ctcaccggggaactggaactgctggacgcgcagcccacgctcaagcgttcactggaaatc
cgggaccagtatcttgaccccatcagctacctgcaggtggagctccttcgtcgcgtccgc
gaagaatcagtgtccggagctgaaatcgatgagcggctccagcgggccatgctgatcacg
gtcaatggcgttgctgcgggcctgcggaacaccggctag

DBGET integrated database retrieval system