KEGG   Arthrobacter sp. ATCC 21022: AUT26_08860
Entry
AUT26_08860       CDS       T04477                                 

Definition
(GenBank) hypothetical protein
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
arz  Arthrobacter sp. ATCC 21022
Pathway
arz00362  Benzoate degradation
arz00621  Dioxin degradation
arz00622  Xylene degradation
arz01100  Metabolic pathways
arz01120  Microbial metabolism in diverse environments
arz01220  Degradation of aromatic compounds
Module
arz_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:arz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUT26_08860
   00622 Xylene degradation
    AUT26_08860
   00621 Dioxin degradation
    AUT26_08860
Enzymes [BR:arz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     AUT26_08860
SSDB
Other DBs
NCBI-ProteinID: AMB40309
LinkDB
Position
1962942..1963730
AA seq 262 aa
MTATHPAPPISEIARRLDQAERKGIAISQFGDLLSLEAAYEVQAELRDLRLARGEHLTGA
KLGFTSEAKMAQMGVKEVIVGFLTSTMEVHNGDRLRLDGSVHPRVEPEVAFRFGQAVPPD
ASEEQIIASVDAVAPALEIIDSRYLNFSFSLADVVADNTSASRYVLGEWATFTDDLAGRT
VTLLVDGSITETGTTSAILGDPLNALREFARVYRRHGVGLPAGAVLLAGAATAAVPLSPG
STITAIVAGIGSVELETAGADS
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaccgcaacccacccagccccaccaatcagcgagatagcccgcagactcgatcaggcc
gaacgtaaaggtatcgccataagtcaattcggcgacctactgtcgctcgaagctgcctat
gaggtacaagccgaattgcgggaccttcgcttggcgcggggagagcaccttacaggcgcg
aagctggggttcaccagcgaggcgaagatggcgcagatgggcgtcaaggaagtgatcgtt
ggattcctcacctcgaccatggaagtgcacaacggcgaccgccttcggcttgacgggtcc
gttcacccacgcgttgaacccgaagtcgccttccgcttcggccaggccgttccgccagat
gcatcggaggaacagatcattgcaagcgtggacgcagtggcacccgcgcttgagatcatc
gattcgcgttatctcaacttctcgttcagtctcgctgacgtcgttgccgacaatacctcg
gccagtcgctacgtcctgggcgagtgggctacctttacggacgatcttgccggtcggacg
gtaacgctgcttgtcgacggatccatcaccgaaacagggaccacttcggctatcctcggt
gaccccctgaacgctctgcgggagtttgcccgagtgtaccgccgccacggagtcggactc
cctgccggtgcagtactgctggcaggtgcagccactgctgcggttcctctctcgccaggg
tccaccatcactgccatcgtcgccggcatcggcagcgttgaactggagacggcaggagct
gactcatga

DBGET integrated database retrieval system