KEGG   Arthrobacter sp. ATCC 21022: AUT26_18320Help
Entry
AUT26_18320       CDS       T04477                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
arz  Arthrobacter sp. ATCC 21022
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMB41947
UniProt: A0A102CW32
LinkDB All DBs
Position
complement(4029242..4030309)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVSPMLAKSVPNIPEVGHYEPKWDGFRTIVFRDGDDVILGSRNEKPMTRYFPE
LVEALKKNLPEKCVVDGEIILISGNRLDFEGLQQRIHPADSRVRMLAEKTPSSFVGFDLL
ALGDEDLTARPFSERRAALEKALADAEPPVYVTPAVTDLERAQEWFVQLEGAGLDGVLSK
PLDGTYQPNKRVMFKTKHERTADCVVAGFRWHKTADVVGSMLLGLYDDSGKLHHVGVVAA
FPMAKRKALVAELEPYQVEIADHPWGEWASQETGAAVGSRMPGAQSRWSAGKDFSFVPLR
PELVIEVAYDYMEGDRFRHTTQFRRWRPDRTPESCTYSQLEEPADYNLGEILKLH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctacccgtgatgccacccgtttcgcccatgctcgccaaatccgtgcccaacatt
cctgaggttgggcactacgaacccaaatgggacgggttccggaccatcgtcttcagggac
ggggatgacgtcatcctgggcagccggaacgagaaacccatgacccggtacttccctgag
ctggtggaggcgttgaagaagaacctgccggagaaatgcgtggtggatggcgagatcatc
cttatttccggcaaccggctcgacttcgaaggactgcagcagcgcatccaccccgccgac
agccgcgtccggatgcttgcagagaagacgccgtcctccttcgtcgggttcgacctcctg
gccctcggggacgaagacctcactgcccggccgttctccgagcgccgtgctgcgctggaa
aaggcgctcgccgatgccgagccgcccgtgtacgtgacgcctgcggtcaccgaccttgag
cgggcacaggaatggttcgtgcagcttgagggagcagggctcgacggcgtgctgtccaaa
ccgctcgacggtacctaccagccgaacaagcgggtgatgttcaagaccaagcatgaacgg
acggcggactgcgtggtggccggtttccgttggcacaagacggcggacgtcgtggggtcg
atgctgctggggctctatgacgattccggcaaactccaccacgttggagtggtggccgcc
ttccccatggcgaagcggaaggcgctggtggccgagttggaaccgtaccaggtggagatc
gcggaccacccctggggagagtgggccagccaggaaaccggagcggcggttggttcgagg
atgccgggggcccaaagccgctggagtgccggcaaggacttttcttttgttcctctgcgg
cccgagctggtgatcgaagtggcgtacgactacatggaaggagaccggttccggcacacc
acgcaattccgcaggtggcggccggaccggactcctgaaagctgcacgtactcacagctg
gaggagccggccgactataacctcggcgagatcctcaagctgcactag

DBGET integrated database retrieval system