KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1375Help
Entry
ASA_1375          CDS       T00500                                 

Gene name
sodB
Definition
(GenBank) SodB
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ASA_1375 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABO89477
UniProt: A4SKQ5
LinkDB All DBs
Position
complement(1429086..1429670)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGIFNNAAQIWNHTFYWHCLSPNGGNEPTGALADAINKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
TLVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgctctgccctacgcaatcaatgccctggaaccgcacatctcc
caggaaactctggaatatcatcacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccaggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggcggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcattgc
ctctccccgaacggtggcaacgagccgaccggcgccctggctgatgccatcaacaaggcg
tttggctccttcgccgagttcaaggatgccttcaccaagtctgccatcggcaacttcggt
tccagctggacttggctggtgaaaaaagccgacggctccctggccatcgtcaacacttcc
aacgccggttgcccgctgaccgaagctggtactacaccgctgctgaccgtcgacctgtgg
gaacacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaaccttctgg
accctggtgaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system