KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1704Help
Entry
ASA_1704          CDS       T00500                                 

Gene name
alr2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00473  D-Alanine metabolism
asa01100  Metabolic pathways
asa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ASA_1704 (alr2)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ASA_1704 (alr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asa01011]
    ASA_1704 (alr2)
Enzymes [BR:asa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ASA_1704 (alr2)
Peptidoglycan biosynthesis and degradation proteins [BR:asa01011]
 Precursor biosynthesis
  Racemase
   ASA_1704 (alr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABO89785
UniProt: A4SLL3
LinkDB All DBs
Position
complement(1788789..1790015)
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLTAFEQNLQTLKT
RLGDKGPQICAIMKADAYGHGIDLLVPSVVKANIPCIGIASNEEARVAREKGFSGRLMRV
RAATPIEVEQALPYKLEELVGSLVSAQGISDIALRHHTTIPVHVALNSAGMSRNGIDLRL
ADAKQDALAMLKLKGITPVGIMTHFPVEEKEDVKLGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLAVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYAAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGESEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccaccttgatcctgggcctgctggccggtcaagccgtc
gcagccccctatctgcctctggcaagcgatcatcgcaacggtgaagtacaaaccgccagc
aacgcctggctggaagtagatctgaccgcgtttgaacagaacctgcagaccctcaagacc
cgcctcggcgacaagggcccgcagatctgcgccatcatgaaagcggatgcctacggtcac
ggtatcgacctgctggtcccctccgtggtcaaggccaatatcccctgtatcggcatcgcc
agcaacgaagaggcccgcgtggcgcgcgagaaggggttcagcggccgcctgatgcgggta
cgggccgccacaccgatcgaagtggaacaggccctgccctacaagctggaagagctggtt
ggcagcctggtgagtgctcaggggatctccgacatcgccctgcgccaccacaccaccatt
ccggtgcatgtcgccctcaactccgccggcatgagccgcaacggcatcgacctgcgtctg
gccgatgccaagcaagatgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagctggggctggcccagttc
aagctggactcccagtggctgctggaagcaggcaagctggatcgcagcaagatcaccatc
catgccgccaactccttcgccaccctggcagtgccggacgcctactttgacatggtgcgc
ccgggcggcctgctctacggcgactccatcccctcctacaccgaatacaagcgggtgatg
gcattcaagacccaggtcgcctcggtcaaccactatgcggcgggcaacacagtcggttat
gaccgcacctttactctcaaacgtgactcctggctcgccaacctgcctctcggttactcc
gacggctatcgccgtgcgctcagcaacaaggcctatgtgctgatccagggtcagaaggtg
ccggtggtcggcaagacctccatgaacaccatcatggtggacgtgaccgatctcaaaggg
gtaaagcccggtgatgaagtggtgctgtttggccgtcagggtgagtcagaagtgaaacag
gctgatctggaggagtacaacggcgccctgttggcggacatgtacaccatctggggctac
accaaccccaagaagatcaaacgctga

DBGET integrated database retrieval system