KEGG   Aerococcus sanguinicola: AWM72_00180Help
Entry
AWM72_00180       CDS       T04253                                 

Definition
(GenBank) anthranilate synthase subunit II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
asan  Aerococcus sanguinicola
Pathway
asan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asan01100  Metabolic pathways
asan01110  Biosynthesis of secondary metabolites
asan01130  Biosynthesis of antibiotics
asan01230  Biosynthesis of amino acids
asan02024  Quorum sensing
Module
asan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AWM72_00180
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AWM72_00180
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AWM72_00180
Enzymes [BR:asan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AWM72_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 DUF1192
Motif
Other DBs
NCBI-ProteinID: AMB94912
UniProt: A0A0X8FE82
LinkDB All DBs
Position
complement(21632..22219)
Genome map
AA seq 195 aa AA seqDB search
MFLMIDNYDSFVYNLAAYFRELGADLEVLSAADLEERRVALDLTAYEGLIISPGPKRPED
ATASLDLFQLAQGKLPILGICLGHQVIAYASGAQVVRAPRPQHGKLHSLRHEDRGLFEGL
PQAFQVTRYHSLCVDPSSLPEELKAEAWTEDGCLMALAKPDACIYGVQFHPEAVLTDYGH
EILARFIQLAKAWRS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgatgattgataattacgattcctttgtttacaacctagccgcctactttagg
gaattgggcgctgacttggaagtcctatctgccgctgacttggaagagaggagagttgct
cttgatctaacggcttatgaaggcctcatcatctctcctggccccaaacgtcctgaagat
gcgacagcttcacttgacctcttccagctagcccagggcaaactgcctatcttagggatt
tgtctcggtcaccaggtgattgcctatgctagcggggcccaggtggttcgcgcgcctcgt
ccccaacacggcaagctccatagcttaaggcatgaggaccgaggtttgtttgagggcttg
ccccaggcttttcaggtcacccgctatcactccctctgcgtcgatccatcttctttgcca
gaagagctcaaggcagaggcctggactgaggacggttgtttgatggccctagccaagcct
gacgcttgtatctacggtgtccagttccatcccgaggccgtcttaaccgactatggccat
gagattctcgctcgctttattcaattagccaaagcttggaggagttaa

DBGET integrated database retrieval system