KEGG   Aerococcus sanguinicola: AWM72_05340Help
Entry
AWM72_05340       CDS       T04253                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
asan  Aerococcus sanguinicola
Pathway
asan00473  D-Alanine metabolism
asan00550  Peptidoglycan biosynthesis
asan01100  Metabolic pathways
asan01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWM72_05340
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AWM72_05340
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AWM72_05340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asan01011]
    AWM72_05340
Enzymes [BR:asan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AWM72_05340
Peptidoglycan biosynthesis and degradation proteins [BR:asan01011]
 Precursor biosynthesis
  Amino acid ligase
   AWM72_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AMB94219
UniProt: A0A0X8FBR4
LinkDB All DBs
Position
1198459..1199547
Genome map
AA seq 362 aa AA seqDB search
MRIVLLYGGDSAEHDISVLTAASILKHLDYKKHQVQPVFIDREGQWIAGELLEEYSLSED
SILYLEASDQQHFYRQGEAEISQGLAVVPTDVLTKDSLAFPALHGPNGEDGTIQGLFEAL
NVPYTGAGVLASAAGMDKIISKQLFQQAQIPQVPFVALTSYQYETERSEVIARIEGQLVY
PVFIKPANMGSSVGITQAQDRDALLQGLETAFHYDTRVVVEQGIEAREIEVAVLGNEEVQ
VSQPGEIVKDQGFYDYEEKYINNSIEMAIPADLPEESAQAIQAYAKKAYLAIDGSGLTRC
DFFVTHNMDIYINEVNTMPGFTQFSMYPSLWAASGLSYEDLLEKLLKLALERFNKKQGLA
NQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgtactactttatggtggggacagcgcggagcatgatatatccgtcttaacg
gctgcttccatcctcaaacatttggattataagaagcaccaagttcagcctgtctttatt
gaccgggaggggcagtggattgctggtgagctgcttgaagaatatagcctcagtgaggat
agcatcctctatctcgaggccagcgaccaacaacacttctaccgccaaggtgaagctgaa
atttcccaagggctggctgttgttccgaccgatgttttgaccaaggatagcctggccttc
cccgccttgcatggaccgaatggggaagatggtacaatccaaggcctttttgaagcactg
aatgtcccttataccggggcaggtgtccttgcttcagcggctggtatggataagattatc
tccaagcagctcttccaacaagctcagatccctcaggtgccttttgttgccctgactagc
taccagtatgagaccgagcgcagcgaagtaattgcccgcattgaggggcagttagtctat
cctgtctttatcaaacctgccaatatgggctctagcgtaggaattacccaggcccaggac
cgggatgccttgctccaaggcctagagacagccttccattatgatacccgggtggtggtt
gaacaagggattgaagctcgggaaatcgaggtggctgtcctcgggaatgaagaggttcag
gtcagccaacctggtgagattgtcaaggaccaaggtttctacgactatgaagagaagtat
attaacaacagcatcgagatggcgattccagccgacctcccagaggaaagcgcccaggct
atccaagcctacgccaagaaggcctatttagctattgatggttcaggcctcacccgctgt
gacttcttcgtgacccacaacatggatatctatatcaacgaggtcaacaccatgcctggt
ttcacccaatttagtatgtatccctctctctgggcagcttcaggcttgtcttatgaagac
ttgctcgagaaattacttaagctggccctagagcgctttaataaaaaacaaggactagcc
aaccaatag

DBGET integrated database retrieval system