KEGG   Aerococcus sanguinicola: AWM72_08365Help
Entry
AWM72_08365       CDS       T04253                                 

Definition
(GenBank) hypothetical protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
asan  Aerococcus sanguinicola
Pathway
asan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asan01100  Metabolic pathways
asan01110  Biosynthesis of secondary metabolites
asan01130  Biosynthesis of antibiotics
asan01230  Biosynthesis of amino acids
Module
asan_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:asan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AWM72_08365
Enzymes [BR:asan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AWM72_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA AAA_18 AAA_16 AAA_24 Mg_chelatase AAA_22 AAA_17 AAA_5 NACHT Cytidylate_kin2 IstB_IS21 PduV-EutP AAA_28 KTI12 SRPRB AAA_3 Viral_helicase1 Hydin_ADK Zeta_toxin MMR_HSR1 Cytidylate_kin RuvB_N
Motif
Other DBs
NCBI-ProteinID: AMB94769
UniProt: A0A0X8FCE4
LinkDB All DBs
Position
complement(1870199..1870666)
Genome map
AA seq 155 aa AA seqDB search
MTQPNLILIGMPGSGKTSLGQALAQKLSLDFLDMDQEIERVSGRTISEIFEEGETAFRSF
ESQLARELDQAKGLIIATGGGVVKDPDNGKPLKKEAKSSLSTAPWTRLLQTLTATNAPYS
RDAWTSSRSSTKSATPSTRQLLISISPTRAAWTSA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcctaatctcatcctcatcggtatgcccggatcgggaaaaaccagcctcggt
caagccctcgcccaaaaactttccttagatttcctagacatggaccaggaaattgaaaga
gtctcgggccgaaccatctctgaaatttttgaagaaggagaaactgccttccgtagcttc
gaatcccaacttgcccgcgagcttgatcaagctaagggccttattattgccacgggtggc
ggggtcgtcaaagatcccgataatggtaagcccttaaaaaaggaggcaaagtcttcttta
tcgaccgccccctggaccagattgctgcagacattaacagcgaccaacgccccctactca
agggacgcctggaccagctccaggtcctctaccaagagcgctaccccctctaccaggcag
ctgctgatttccatatctccaaccagggcagcctggaccagtgcctga

DBGET integrated database retrieval system