KEGG   Hoyosella subflava: AS9A_2484Help
Entry
AS9A_2484         CDS       T01514                                 

Definition
(GenBank) Putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
asd  Hoyosella subflava
Pathway
asd00250  Alanine, aspartate and glutamate metabolism
asd00410  beta-Alanine metabolism
asd00430  Taurine and hypotaurine metabolism
asd00650  Butanoate metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd02024  Quorum sensing
Module
asd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AS9A_2484
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS9A_2484
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS9A_2484
   00430 Taurine and hypotaurine metabolism
    AS9A_2484
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AS9A_2484
Enzymes [BR:asd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AS9A_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEF40931
UniProt: F6EFK2
LinkDB All DBs
Position
complement(2541809..2543281)
Genome map
AA seq 490 aa AA seqDB search
MAGLKCRGKFLRHSARIFRLVYAPDMPLSQPSGGHHSHRRSVSVNPIFTREPLEIPHDRF
PRDQLDPDTAYQIVHDELMLDGNARLNLATFVSTWMEPQARTLMAECFDKNMIDKDEYPG
TAELEQRCVRMLANLWHAPPADAPTGCSTTGSSEACMLAGLALKRRWQQAGGEKRGRPNL
VMGVNVQICWDKFATYWDVEPRLVPMEGDRYHLTADEAVKYCDENTIGVVAILGSTYDGS
YEPVADICRALDDLQSRTGWNIPVHVDGASGAMIAPFCDPDLEWDFRLDRVASINTSGHK
YGLVYPGVGWVVWRDAEALPDELVFRVNYLGGEMPTFALNFSRPGAHVAAQYYNFIRLGF
DGYRRVQRTCRDVAMHLSSAIAELGPFELVTDGSELPVFAFTVRNDVTGYSAFDVSAALR
ESGWLVPAYTFPANREDLAALRVVVRNGFSHDLAERFLDEVKRVLPRLHRQDSPQRGSEA
ASFSHSAKRT
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcctgaaatgtcgcggcaagtttttgcgacactccgcgagaatcttccggctg
gtctacgctcccgatatgcccctgtcacagccttccggcgggcaccactctcaccggcgt
agcgtcagcgtcaaccccatcttcacgcgagaaccactcgagatcccgcacgatcggttt
ccccgtgaccagcttgatcctgataccgcgtaccagatcgttcacgacgaactgatgctt
gacggtaatgcccgtctcaacctcgcgacgttcgtgtcgacatggatggaaccgcaggcc
aggacgctcatggccgaatgtttcgacaagaacatgatcgacaaggacgagtacccgggc
acagccgaactcgaacaacgatgcgtgcgcatgctcgcgaacttgtggcacgccccgcca
gctgacgcgccaacaggctgctcgacaactgggtccagtgaggcatgcatgctggctggc
cttgcgcttaaacggaggtggcagcaagcaggcggagaaaagcgcggccgacccaatctg
gttatgggcgtcaacgtccagatttgctgggacaagttcgccacctactgggacgttgaa
ccgcggctcgtgccgatggagggtgacaggtaccacctcaccgcggacgaagctgtgaag
tactgcgacgagaacaccatcggcgtcgttgcaatcctcggctcgacgtacgacgggagt
tatgaacccgtcgccgacatctgtcgtgcgctcgacgacctgcaatcccgcaccggctgg
aacattcccgttcacgtcgacggcgcttcgggcgccatgatcgcacccttctgcgatcca
gacctggagtgggacttccgcctcgaccgcgtcgcatcgatcaacacctcgggacacaag
tacggtctcgtttatccgggtgtcggatgggtggtgtggcgggatgcggaagcattaccc
gatgagctcgtgttccgggtgaactacctgggcggtgagatgcccaccttcgcgctgaat
ttctcacggccgggagctcatgttgccgcgcagtactacaacttcattcgcctcgggttc
gacggatatcggcgggtccagcgcacctgccgggacgtggcgatgcacctctccagtgcc
atcgccgaacttggtccctttgaacttgtcaccgatggcagcgagctgccagtgttcgcc
ttcacggtgcgcaacgacgtcactggctattcggcgtttgatgtgtccgcggcgctgcgt
gaatcaggctggctcgtacctgcttacaccttccccgccaatcgggaggatctcgccgca
ttgcgcgtcgtcgtgcgaaacggattcagccacgacctcgctgagcgtttcctcgacgaa
gtcaagcgtgtgctgccgagattgcaccgacaggacagtccgcaacgcggcagcgaagcg
gcatctttctcgcacagcgcgaagcggacgtag

DBGET integrated database retrieval system