KEGG   Hoyosella subflava: AS9A_3416Help
Entry
AS9A_3416         CDS       T01514                                 

Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
asd  Hoyosella subflava
Pathway
asd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01130  Biosynthesis of antibiotics
asd01230  Biosynthesis of amino acids
asd02024  Quorum sensing
Module
asd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AS9A_3416
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AS9A_3416
Enzymes [BR:asd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AS9A_3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AEF41857
UniProt: F6EQ36
LinkDB All DBs
Position
3491530..3492639
Genome map
AA seq 369 aa AA seqDB search
MTTHIDEHASKHASSATPTLHPTSNLHVRSMAALPSPRQLLDELPLGDTRAELVESSRMD
IRTIVSGADDRLLVVTGPCSVHDPAAALDYASKLAPLAAQFEQELCVVMRVYFEKPRTTV
GWKGLINDPDMDETYDVPRGLRLAREVLLGVLDAGLPVGCEFLEPTSPQFIADAVSWGAI
GARTTESQVHRQLASGLSMPIGFKNATDGDIQVAIDGCRAANAAQVFFGSDFDGRAALVS
TTGNPDTHIILRGGRGGPNYQATNLETATGLLSKAQLPTRLMVDASHANSGKDHVRQAGV
AGEIADMIAGGTDEISGVMLESFIVGGRQEPGPGPLVYGQSVTDACMDFETTEGVLERLA
NAVQKRRQQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccatatcgatgagcacgcaagcaagcatgcctcatccgccacgcccactctc
catccgacgagcaatctgcacgtccgctcgatggcagcgcttccgtcgccccgtcagctc
ctagatgaacttccacttggtgacacgcgcgcggaactcgtcgagagcagccgaatggac
attcgtaccatcgtttccggcgctgacgatcgcctgctcgtcgtcacaggcccctgctcg
gtgcacgaccccgccgcagcgctggactatgcgtcaaagctcgcgcctctcgctgcacag
ttcgagcaagaactgtgcgtcgtgatgcgggtgtactttgagaagccgcgcaccacggtt
ggctggaagggtctcatcaacgaccccgacatggatgaaacctatgacgtgccgcgcggt
ctgcgcctcgcccgtgaggtcctgcttggcgttctcgatgcgggccttccggttggttgc
gagttcctggaaccgacgagcccgcagttcatcgccgatgctgtgagctggggtgcgatc
ggtgcccggaccaccgaaagccaggttcaccggcagctcgcgtcagggctgtccatgccg
attggcttcaaaaacgcgaccgacggtgacatccaggtggctatcgacggctgccgggca
gccaacgcagcgcaggttttcttcggatcggatttcgatgggcgggcagctctcgtctcg
acgaccggtaaccctgacacgcacatcattcttcgtggtggcaggggcggccccaactac
caggcgacaaacctggaaacggcgacggggctgctcagcaaggcacaattgcccacacgg
ttgatggtggacgccagccacgcgaactcaggtaaagatcatgtccggcaggcaggcgtt
gccggggaaatcgctgacatgatcgcggggggcacggatgaaatatccggcgtcatgctg
gaaagcttcatcgtcggcggccgccaggagccgggtcctggaccgctggtatacggccag
tccgtcaccgacgcatgcatggacttcgagaccacagaaggcgtgctcgagcgtctcgct
aacgctgtccagaagcgccgtcagcagtag

DBGET integrated database retrieval system