KEGG   Hoyosella subflava: AS9A_3620Help
Entry
AS9A_3620         CDS       T01514                                 

Definition
(GenBank) Fatty-acid synthase I
  KO
K11533  fatty acid synthase, bacteria type [EC:2.3.1.-]
Organism
asd  Hoyosella subflava
Pathway
asd00061  Fatty acid biosynthesis
asd01100  Metabolic pathways
asd01212  Fatty acid metabolism
Module
asd_M00082  Fatty acid biosynthesis, initiation
asd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AS9A_3620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:asd01004]
    AS9A_3620
Enzymes [BR:asd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     AS9A_3620
Lipid biosynthesis proteins [BR:asd01004]
 Fatty acid synthase
  Bacteria type
   AS9A_3620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 ketoacyl-synt Ketoacyl-synt_C DNA_pol_B_N MaoC_dehydratas SAT FAS_I_H Fas_alpha_ACP 4HBT_3
Motif
Other DBs
NCBI-ProteinID: AEF42058
UniProt: F6ES54
LinkDB All DBs
Position
complement(3689333..3698503)
Genome map
AA seq 3056 aa AA seqDB search
MTLSDHPTFSSRSSQTANNTLALAAQFRSGTSYTISFGGQGAEWLPAIRELIHDGGFAPE
LTDLVSEANAMLAPVEAELQIVRSEFSPLQWAEEPEAGIDTQTAAISLPGVFLAQLAALR
LLELEGLDTVEVAPAGAAGHSQGVLGVEVLRQGGTRNAELLAIAQLMGAAASLTGRRRGL
RSVGSHSAMVSVSKVDPQRIADIVAEATSGMHPDLAPVVAIRNGRRRVVISGRPEQIERI
RLRCAEIAAKEKEERAERTRGGEIFAPVFDPIAAEVAFHHPSMSAAVELAVEWAEECGID
TDLTRSLATSALVDPVDWVAEVERLADTGAKWLLDVGPGDVFARLTASSVRGLGIAVVPA
GTRGGHRNLFTPGAAPEAPSPWTRFAPRVVQLPDGTKVAETRFSRLTGRSPIVLAGMTPT
TVDAKIVAAAANAGYWSELAGGGQVTESIFNNRVEDLKKILDPGRSVQLNAMFLDPYLWK
LHVGGKRLLQKARVAGAPFDGVTITAGIPELDDALSIIEDLNNAGLSYIAFKPGTVTQIR
SVIRIAAEVPHQTVIVQIEGGKAGGHHSWEDLDDLLLETYAELRSRPNVVIAAGGGIGTP
ERAADYLTGRWSVAHGFPAMPVDSILIGTAAMAALEATTSPEVKKLLVETQGTPDWIPAG
GAENGMSSGRSQLGADIHEVDNTASKTGRLLDEVAGDAAAVKRRRDEIVAALNGTAKPYF
GDVAEMTYKEWLERYVELTVGAAEHAFDIGGDFSDAEDTVKSVWIDETWRERFASMIRRA
EARLNPADRGRIASLFSDPVHLERPHAAIAELAVAYPEAATTVLHPGDVPFFMSLCRTPG
KPVNFVPVIDAEVRRWWRSDSLWQAHDPRYSADQVCVIPGTVSVAGITKADEPVADILKR
FEDATVEAVDNGATVKAVGAEPVQVTSRRRADADGALGILLAAPDAIWGTRLTKNPVFRI
GPPSSWEIVSDDLARHAATGAVLRASGQNVAHLECPVPGGKVSLRLTVPASCATGGAPIV
TAEDTSAAMSALLEIAAGGGELPAVVDGVAEFTTTYQPELVADHAAVTATGIGSDMMPGT
VPDVLVGTCWPAVFAAIGAAEAADGSPCVEGLLDLVHLDHNASLLSSLPTEAVMLDVRAK
LGRVVDAEVGRVIEVEVEIRTAGDVIATLTERFAIRNRTGSASLTDPVSVASKSAESTPR
KMIRKVSFKAPTAMRAFARISGDHNPIHTSDGAAALAGLPGPIVHGMWLSAAAQHVLSGR
DISSDERKFPAIEAWTTRFLSPVLPGDTIDVRVERISIDSGREIVEVTCKVGDTPVMIGT
ARMAPPRVVYAFPGQGIQHKGMGLDAMSRSKAARAVWERADAHTREVLGFSILAIVRDNP
TEVKARGVKHYHPDGVLFLTQFTQVAMATLGLAQIAELKESGAFIEGAYYCGHSVGEYNA
LAAVAEVLPLEAVLELVFRRGSAMHTLVPRDAKGRSDYRLGAIRPSQAGIADSDVTAYID
GIAEETGEFLQVVNYNLRGSQYAIAGTVKGLEVLESDIDARRTALGGKRAFILVPGIDVP
FHSSVLLGGVPEFREKLRELVPHDIDPQILVGRYIPNLVPRLFNLGRDFVQEIADLVDSD
PMKAVLADFDSWTAKPVALCREILIELLAWQFASPVRWIETQDLLFTDELEGGVAVERFV
EIGTGSAPTLANLAKSTLALPGFVAKPEVFNVERDALAVKSQDESQDFDDDIEDEPAEAT
APEAAAAPAPEAAPAPAAPTAPAGGPRPDDLPFSAADATRALIASLTKLRPEQIGSADTI
EALCDGVSSRRNQVLLDLGSELGLGAIDGAAEADIPTLSQTVNKLARTYKPFGPVLTDTF
GDQLRKVFGPTGKRPAYIGDVVTDVWELGPGWVKHVTAELALATREGTSSRGGELGSISG
STADDLIDAAVQSVATRNGVTVGKPSAAGAGGGTVDSATVSALTESITGPDGVLASTARH
LLEELGLSAPKSLADSDDASAELAELVAQELGSDWARQVAPGFDARKAVVFDDRWASARE
DLAKLWIGDNADSAGTFTGTGQIIATQARWWARKAEEAGRPGLVETYSRLAAEAEDTSTG
KWASEVAIITGASEGSIAAAVAGDLLNGGATVIATTSRLNSDRVGFYKELYRANARAGAT
LWVVPANMAAFSDVDALVDWIGSEYAISAGPETKVLKKALTPTMLVPFAAPRVSGDLADA
GAKAELQMRVLLWSVEKMIGGLSAIGKDNDIDNRLHVLLPGSPNRGIFGGDGAYGESKAA
FDAIIAKWKSESSWAQRVTFTHALIGWVRGTGLMGGNDPLVRFVEAAGVTTWSTADMAQE
LLKGCTADARSYAESEPVVLNLTGGLDTADLDLSALAGKAQAAAEEEAEEESEAEADNLV
GALPPAPAADPVRRLGWSKVAADPADMVVIVGAGELGPYGSARTRFEMEVSEELSAAGVL
ELAWTTGLITWHNDPKPAWYDAESGDEVAEEDIWELYHDRVVEQCGIRPYENDGALQDGT
QPLLSSVFLDKDLTFTVSGEAEARAFVSAAPDSTVIESLESGEWQVTRKAGTEIRVPRRV
EMTRTVGAQIPLNFDATRWGIPAELADSIDRVALWNLVTTVDAFLSSGFTPSELLRWVHP
AEVANTQGVGIGGMKSMRSLYIDAILGENRPNDILQEALPNVIAAHVVQSYVGSYGDMLH
PVAACATAAVSVSEGFDKIKLGRAQFVVAGGFDDLGVEGITGFGDMNATAHTQAMLDKGI
DPRRFSRANDRRRGGFVEANGGGTILLARGDVAFELGLPVLGVVGWTGTFGDGAHTSIPA
PGIGALGAGRGGQASKLARELGKLGVTADDISVISKHDTSTGANDPNESELHERVASALG
RSDGAPLFVVSQKSLTGHSKGGAAAFQMIGLCQVLAQGVVPPNRSLDCVDDVLAEHPHLV
WVREALKLGDKLPLKVGLVTSLGFGHVSAFVAIVHQEAFLQALGEERAADYLARAGKRVA
DGRRRIAAAMVGGPALYERPENRRFESQVRESEAALLLDPEARLGESGTYPVAPSR
NT seq 9171 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgagcgatcatccgaccttttcatcccgcagttcacaaacagctaataacact
cttgcgctagcagcccaattccgcagtggcacttcgtacaccatcagcttcggaggacag
ggcgccgagtggctgcccgcgatccgcgaactcattcatgacggcggctttgcccccgaa
ctcaccgatctcgtttccgaggccaacgcgatgctcgcgccggtggaggctgaactccag
atcgtgcgctccgagttctcgccacttcaatgggccgaggagccagaggcggggatcgac
actcagacagcggcgatttcccttccaggcgtcttcctcgcgcagcttgcggccctgcga
ctgctcgaacttgaaggccttgacaccgtagaggtcgcgcccgcgggcgctgcgggccac
tcacagggtgtgctgggtgttgaggttctgcgccagggcggcacccgcaacgcagagctc
ctcgccatcgctcagctgatgggtgcagctgcatcactgaccggccgccgccgcgggttg
cggtccgtaggctcgcactcggctatggtctccgtctccaaggtagacccgcagcgcatc
gccgatattgtcgctgaggccacgagcgggatgcacccagacctcgcacccgtcgtcgct
atccgcaacggccgtcgccgcgtggtcatctccggccgccctgagcagatcgagcgtatc
cgtctgcgctgcgccgagatcgctgcgaaggagaaggaagagcgtgccgagcgtacgcgc
ggcggcgaaatcttcgcgcctgtcttcgaccccatcgcagcagaggtcgccttccaccac
ccctccatgtccgcggccgtcgaactcgccgtggaatgggcggaagaatgcggcatcgac
actgacctcacccgtagtctcgcgacaagcgcgctcgtcgatcctgtcgactgggtcgct
gaagtcgagcgcctcgccgacaccggcgcaaaatggctcctcgatgtgggtcccggcgac
gttttcgcgcgtctgaccgcctcatctgtgcgcggactgggcatcgcggtagttcctgcc
ggaacgcgcggcggacaccgtaacctcttcacccccggtgcagcccccgaggcgccaagc
ccgtggacccggttcgcgccgcgggtcgttcagcttcctgacggcaccaaggttgcggaa
acccgcttctcccggctcaccggtcggtcgccgatcgtccttgccggtatgacccccacc
accgtagacgcgaagattgtcgcagcggccgcgaacgctggctactggtcagagctcgca
ggcggcggccaagtaaccgagtcgatcttcaacaaccgtgtcgaggatctgaagaagata
ctcgacccgggccgttccgttcagctcaacgcgatgttcctcgatccgtacctctggaag
ctgcacgtgggcggtaagcgcctgctgcagaaggcgcgcgtcgctggcgccccatttgac
ggcgtgaccatcaccgcaggcattcccgaactcgatgacgcgctgtcgatcatcgaggac
ctgaacaacgctggcctgtcctacatcgcgttcaaaccgggcaccgtcacccagatccgc
tcggtcatccggatcgcagcggaggttccgcaccagaccgtcatcgtccagatcgaaggc
ggcaaggctggtggccaccactcctgggaagatcttgatgatctcctccttgagacctac
gccgaactccgctctcgcccgaacgtcgtaatcgccgccggcggcggaatcggaaccccc
gagcgtgctgccgactacctgaccggacgctggtctgttgcacacggcttccccgccatg
ccagtggactcgatcctcatcggcacggcggcgatggcagcgctcgaagccaccacttcg
cctgaggtcaaaaagctgctcgtcgagacgcagggcacgccggactggattcccgccggc
ggcgcggagaacggcatgtcctccgggcgcagccagctcggcgcagacattcacgaggtc
gacaacaccgcttcgaagaccggccgcctgctggacgaggttgcgggcgacgcagcggcg
gtcaagcgccgccgcgatgaaatcgtcgccgcgctcaatggcacagcgaagccgtacttc
ggtgatgtcgcagaaatgacctacaaagaatggctcgagcgctacgtcgaactgaccgtg
ggcgcggccgagcatgcgttcgacatcgggggtgacttctcggacgcggaggacactgtc
aagtccgtatggattgacgagacctggcgtgagcgcttcgcatcgatgatccgccgcgct
gaggcacggctgaacccagcggaccgcggacgtatcgcctcgctgttctccgaccccgtg
cacctggagcggccacacgccgccatcgctgagcttgcggtcgcctacccggaggctgca
accaccgtgctgcaccccggcgacgttccattcttcatgtcgctctgccgcacacccggc
aagccagtcaacttcgttcccgtcatcgacgccgaagtacgccgctggtggcggtcagat
tcactgtggcaggcccacgatccgcgctacagcgccgatcaggtatgtgtcatccccggc
accgtatccgtcgcaggaatcaccaaggcagacgagccagtcgctgacattctcaagcgt
ttcgaggatgcgaccgtcgaggctgtcgacaatggggccacggttaaggccgtcggcgct
gagcccgttcaggtgacgagccgccgccgcgcggacgccgatggcgctctcggcattctc
ctcgccgcgcccgacgccatttggggaacccgcctcaccaagaaccccgtgttccgcatc
ggtccgccgtcaagctgggaaatcgtctcggacgaccttgctcggcacgccgctactggt
gccgtcctgcgtgctagcgggcagaacgtcgctcacctcgagtgcccggtaccaggtggc
aaggtctcgctgcgccttaccgttcccgcgtcgtgcgccacaggtggtgctccgatcgtc
accgctgaggacacaagcgccgcgatgagcgcgctgctcgagatcgctgcaggcggcggt
gaactgcccgcggtcgtcgacggagtcgccgagttcaccacgacctaccagccagaattg
gtcgccgaccacgctgccgtcacagcgaccggaatcgggtccgacatgatgcccggcacg
gtaccggacgttctcgtcggcacttgctggccagcggtgttcgcagctatcggtgctgct
gaggctgccgatggatcaccatgcgtcgagggtctgctcgatctcgtccacctcgatcac
aacgcgtcgctgctcagcagcttgcccacggaagctgtcatgctggacgtgcgtgcgaag
ctcggccgcgttgttgacgccgaggttggccgcgtcatcgaggttgaggttgaaatccgc
accgccggtgatgtgatcgctacgctcaccgagcgttttgcgattcgcaaccgcaccggc
agcgcatcgctcaccgacccggtttcggtcgccagcaagagcgcggaaagcacgccacgc
aagatgatccgcaaggtcagcttcaaggccccgaccgcaatgcgtgcgttcgcccgcatc
tcaggcgatcacaacccgatccacaccagcgacggtgcagctgcacttgctgggctgccc
ggcccgatcgtgcacggcatgtggctctcagcagctgcccagcacgtcctctcggggcgc
gacatcagcagcgatgagcgcaagttccccgccatcgaggcgtggacaacccgtttcctc
tccccggtgctgcccggcgacaccatcgacgtccgggttgagcgcatcagcatcgattcc
ggccgcgagatcgtcgaggtgacctgcaaggtcggcgacactcccgtcatgatcggcacc
gctcgtatggcgccgccgcgggtcgtctacgccttccctggccagggcatccagcacaag
ggcatgggactcgacgcgatgagccgctccaaggcggctcgggcagtgtgggagcgtgcc
gacgcgcatacccgtgaggttctcggcttctcgatcctcgcgatcgttcgagacaacccg
accgaggtcaaagcgcgcggcgtgaagcactaccacccggacggcgtgctcttcctgacc
cagttcacacaggtcgcgatggccaccctcggtctcgcgcagatcgctgaactgaaggaa
tccggcgcgttcatcgaaggcgcgtactactgcggccactccgtcggtgagtacaacgcg
ctcgccgcggttgccgaggtgctgccgctcgaggccgtgctagaactcgtgttccgccgc
ggctccgcgatgcacacgcttgttccgcgcgacgctaagggacgcagtgactaccgtctc
ggcgcgatccgcccgtcgcaggccggtatcgcagattccgacgtcaccgcgtacatcgac
ggcatcgccgaagagaccggtgagttcctgcaggtcgtcaactacaacctgcgcggctca
cagtatgcaattgccggtaccgtcaagggtctcgaggtgctcgagtccgacatcgacgca
cgccgcaccgctctcggcggtaagcgcgcgttcatcctggtccctggtatcgacgtgccg
ttccactcctcggttctgctcggcggtgtgccagagttccgggagaagctgcgcgaactc
gttccgcatgacatcgacccgcagatcctcgtcgggcgctacatcccgaacctcgtgcca
cggctgttcaacctcggccgggacttcgttcaggagatcgccgacctcgttgactcagac
ccgatgaaggcagttctcgctgacttcgacagctggaccgccaagcctgtcgcgttgtgc
cgcgagatcctgatcgagctgctggcctggcagttcgcgagtcccgtccggtggatcgag
actcaagacctgctgttcaccgatgaactcgaaggtggcgtcgcggttgagcgattcgtg
gagatcggcaccggaagtgcgccgaccctcgcgaacctcgcgaagtccacgctggccctg
cccggattcgtcgcgaagcctgaggtcttcaacgtcgagcgtgacgcgctcgcggtgaag
agccaggatgagagccaggacttcgacgacgacatcgaggatgagccagccgaggcaact
gctcctgaggcagccgccgcaccagcaccggaagcggctcccgctccagcagcacctact
gcacctgctggtggtccacgtccggacgacctgcccttcagtgccgcagacgccacacgc
gcgctcattgcgtcgctgacgaagctgcggccggagcagatcggttccgctgacaccatc
gaggcgctgtgcgacggtgtctcctcacgccgcaaccaggtgcttctcgacctcggttcc
gaactggggctcggtgcgatcgatggtgccgcagaagcggacatcccgaccctgtcgcag
acggtcaacaagctcgcccgcacctacaagccgttcggcccggtgctcaccgacacgttc
ggtgaccagctccgtaaggtcttcggcccgacgggcaagcgccccgcgtacatcggcgac
gttgtcaccgacgtgtgggaactgggcccaggctgggtgaagcacgtcaccgcggagctg
gcgctcgcaacccgcgagggcacaagctcgcgcggtggtgaactcggcagcatcagcggc
agcacggctgacgacctgatcgacgcggccgtgcagtccgtcgcaacacgcaacggtgtc
acggtgggcaagccttccgcagctggcgccggcggcgggaccgtcgactcggccacggtc
tcggctctcaccgagtcgatcaccggaccggatggcgtcctcgcgtcgaccgcacgccac
cttctcgaagagctgggcctttccgcaccgaagtccctcgccgactccgacgacgcatcc
gctgagcttgctgagctggtcgcgcaggaactcggcagcgactgggcacgccaggtcgcg
ccaggattcgatgcacgtaaggcagtcgtgttcgacgaccgctgggcgagcgctcgcgaa
gacctcgcgaagctctggatcggcgacaacgctgactcagctggcacgttcaccggcact
ggtcagatcatcgccacccaggcgcgctggtgggcccggaaggcagaggaagctggacgt
cccggtcttgttgagacctactcgcgtctggctgctgaagccgaggacacctcgaccgga
aagtgggcctcagaggtcgcgatcatcacaggtgcaagcgaaggttccatcgccgcggca
gtggccggggacctgctgaacggcggcgcaacggttatcgcaaccacctcccgcctgaac
tcggatcgggtcggcttctacaaggagctgtaccgggcgaatgcccgcgctggagccacc
ctgtgggtcgtcccggccaacatggcagcgttcagcgacgtcgatgcactcgtcgactgg
attggcagcgagtacgcgatcagtgcaggcccggagaccaaggtgcttaaaaaggcactc
accccgacgatgctggttccgttcgcggcgccacgcgtcagcggtgacctcgccgatgcg
ggcgccaaggcggaactgcagatgcgcgttctgctgtggtcggtggagaagatgatcggc
ggcctgtcagctatcggcaaggacaacgacatcgacaaccggctgcacgtcctgctgcca
ggttcaccgaaccgcggcatcttcggtggcgacggtgcttacggcgagtccaaggccgcg
ttcgacgcgatcatcgccaagtggaagtccgagtcgagctgggcgcagcgtgtcaccttc
acgcacgcactgatcggctgggtccggggcaccggactcatgggcggcaatgacccgctg
gttcgcttcgtcgaggctgcgggcgtcacgacctggtccaccgcagacatggcccaggag
ctgctcaagggctgcactgcggacgcccgcagctatgcggagtccgagccagttgtcctg
aacctcaccggcggactcgacaccgctgacctcgacctttctgcgctggccggcaaggca
caggcggcagccgaggaagaggcagaggaagagagcgaagcggaggccgacaacctcgtc
ggcgcattgccaccggcacctgcagctgacccggtacgccgtctcggctggagcaaggtc
gcggcggaccccgccgacatggtcgtcatcgtcggcgccggggaactcggaccgtacggc
tcggcgcgtacccgcttcgagatggaggtctccgaagaactgtcggcggccggtgtcctg
gaactcgcctggaccacgggtctcatcacctggcacaacgatccgaagccagcgtggtac
gatgccgaatccggtgacgaggtcgctgaagaggacatctgggagctctaccacgaccgc
gtcgtcgagcagtgcggcatccggccgtacgagaacgatggggcactgcaggacggcacc
cagccgctgctcagctccgtcttcctcgacaaggacctgaccttcacggtcagcggcgag
gcagaagcgcgtgcattcgtctccgcagcaccagactccacggtcatcgaatcactggag
tccggtgaatggcaggtcacccgtaaggctggcaccgagatccgcgtcccgcggcgtgtc
gaaatgactcgcaccgtcggcgcccagatcccgctgaacttcgacgcaacccgttggggc
atcccagctgagctggctgactccatcgaccgggtcgcactgtggaacctggtcaccacg
gtggacgcgttcctcagctccggattcacgccatccgaactgctccgctgggtccacccg
gcagaggtcgccaacacgcagggcgtcggcatcggcggcatgaagtcgatgcgttcgctc
tacatcgacgcgatcctcggcgagaaccggccgaacgacatcctgcaggaagccctgccg
aacgtcatcgcggctcacgtcgtccagtcctacgtcggcagctacggcgacatgctccac
ccagtggcggcatgcgcgaccgcagcagtgtcggtctcggagggcttcgacaagatcaag
ctcggacgggcccagttcgtggtcgccggtggcttcgatgaccttggagtcgaaggcatc
accggcttcggtgacatgaacgcgaccgcccacacccaggcgatgctggacaagggcatc
gatccgcggcgcttctcacgcgccaacgatcgacgccgcggcggattcgtcgaggccaac
ggtggcggcaccatcctgctggcgcgcggtgacgtcgcgttcgaactgggactgccggtg
ctcggtgtggtcggctggaccggaaccttcggtgacggtgcacacacgtccatcccggca
cccggtatcggtgcgctcggtgctggccgtggcggccaggcttccaagctcgctcgcgaa
ctcggcaagctcggcgtcaccgcggacgacatctcggtgatctccaagcacgacacgtca
accggcgcgaacgacccgaacgagtccgaactgcacgagcgcgttgccagcgctctcgga
cggtcggatggcgcaccactgttcgtggtctcccagaagtccctcaccggtcactcgaag
ggcggtgcggcagcgttccagatgatcggtctctgccaggtcctcgcccagggcgtggtt
ccgccgaaccgcagcctcgactgcgtcgacgacgtcctcgctgagcatccccacctggtg
tgggtgcgtgaggcactgaaactgggtgacaagctgccgctgaaggtcggtctggtgacc
agcctcgggttcgggcacgtgtccgcgttcgtcgcgatcgttcaccaggaggcgttcctc
caggcactcggtgaagagcgggccgctgactacctggcccgggcaggcaagcgcgtcgcc
gacggccgccgccgtatcgcggctgccatggtcggtgggccggcactgtacgagcgccct
gagaaccgcaggttcgagtctcaggtccgcgagtctgaggccgcgctgctcctcgatccg
gaggcccgcctcggtgagtccggcacgtacccggtagctccatcccggtaa

DBGET integrated database retrieval system