KEGG   Hoyosella subflava: AS9A_3985Help
Entry
AS9A_3985         CDS       T01514                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
asd  Hoyosella subflava
Pathway
asd00020  Citrate cycle (TCA cycle)
asd00480  Glutathione metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
asd01210  2-Oxocarboxylic acid metabolism
asd01230  Biosynthesis of amino acids
Module
asd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:asd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS9A_3985
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AS9A_3985
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AS9A_3985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEF42421
UniProt: F6EIC9
LinkDB All DBs
Position
complement(4050602..4051825)
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGMENRDATDDQVTVDA
ANAIKKHGAGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNIPRL
VPGWTKPVVVGRHAFGDQYRATDFKVHQAGTVTLTFTPEDGSEPIQHEVVKMPEDGGVIL
GMYNFKKSIQDFARASLAYGLQQNYPVYLSTKNTILKAYDGMFKDEFQRVYEEEFKSEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHFRMHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPAVVEFAHQLE
DVVIKTVESGQMTKDLAVLVGGDQGYLSTEEFLGALDDNLQAAVKDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgagggcaccgtcgtggaactggatggcgacgaaatgacccgt
atcatctggcagttcatcaaagacaaattgatccatccgtacctggatgtgaaccttgaa
tattacgacctgggcatggaaaaccgcgacgccaccgatgatcaggtaacggtcgacgcc
gcgaacgccattaagaaacacggtgcaggtgtcaaatgcgccaccatcaccccagatgaa
gctcgcgttgaagagtttggcctgaaaaagatgtggcgttcgccgaacggcaccatccgc
aacatccttgggggcacgattttccgtgcccccatcattatttccaacattccccgcctc
gtgccgggctggacgaaaccggttgttgtcggccgccacgcatttggtgaccagtaccgc
gccaccgatttcaaggtgcatcaggctggcaccgtgactctcacctttacgccagaggat
ggcagcgagccgatccagcatgaagtagtgaagatgcccgaggacggcggcgtcatctta
ggtatgtacaacttcaagaagtcgatccaggacttcgcccgagcttcgcttgcgtacggc
ttgcagcagaactatcccgtgtacctgtcgaccaagaacactatcctcaaggcgtacgac
gggatgttcaaggacgagttccagcgcgtgtacgaagaggagttcaagtcagagttcgat
gccgccggacttacgtacgaacaccggctgatcgacgacatggtggcgtctgccctgaag
tgggaggggggctatgtctgggcgtgtaagaactacgacggtgacgttcagtccgatacg
gtcgctcaaggctacggttcgctcgggctgatgacctcggtgctgatgacgcccgatggc
aaaactgtcgaagcagaggccgcccacgggacggtgacacgtcacttcaggatgcatcag
caaggaaagcccacctcgaccaaccccatcgcgtcaatcttcgcgtggacgcgtggcctc
gagcatcgcggcaaactcgacaacaccccagccgtggtggaattcgcgcaccaactcgag
gatgtcgtcatcaagaccgtggaaagcggccagatgacgaaggatcttgcggtgctagtc
gggggagaccagggctacctgagcacggaggagttcctcggcgcgctcgacgacaacttg
caagccgccgtcaaagacatctga

DBGET integrated database retrieval system