KEGG   Hoyosella subflava: AS9A_4044Help
Entry
AS9A_4044         CDS       T01514                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
asd  Hoyosella subflava
Pathway
asd00473  D-Alanine metabolism
asd01100  Metabolic pathways
asd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AS9A_4044
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AS9A_4044
Enzymes [BR:asd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AS9A_4044
Peptidoglycan biosynthesis and degradation proteins [BR:asd01011]
 Precursor biosynthesis
  Racemase
   AS9A_4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEF42478
UniProt: F6EII6
LinkDB All DBs
Position
complement(4109587..4110636)
Genome map
AA seq 349 aa AA seqDB search
MVVVKADGYGHGAVPVARAALAAGAAQLGVATVDEAVHLRDAGIEAPLLCWLHTPDTDFA
PVLSRNVDIGVSSPRHLDGVLRSVRLSGIQARVAVKVDSGLNRNGVSAFEWPVLRDALRK
AVAEEAVVMTSFFSHLAHADEPDHPIIDQQAARFRETVADAEKHGLETGLLHLSNSAATM
TRPDLRFDMVRPGIALYGLSPVPERGQMGLRPAMTARARVALIKRVAAGEGVSYGHVWIA
PRDTTVALLPVGYADGVSRLLTGKFGVQINGHRYPAVGRVCMDQFVVDLGPGGGAEGAAA
VKEGDTAVLFGPGDEGESLAQDWADALGTIHYEVVTGIKGRAVRTYMGG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcgtcaaggcagatggttacggccatggtgcggtaccagttgcacgtgcggcg
ctcgctgcaggtgcagcgcaactcggcgtcgcgacggtagatgaggcggtacaccttcgc
gatgcgggtattgaggcgccgctgttgtgctggctgcacacgcccgacaccgacttcgcg
cctgtgctttcacggaacgtcgacattggtgtgtcttcgccgcgccaccttgacggcgtt
ctccggtcggtgcggctatctggaatacaggcacgcgttgcggtgaaggttgattcgggg
ctcaaccgcaacggcgtctcggctttcgagtggcccgtcctgcgagatgcccttcggaaa
gccgttgcggaagaagcggtcgtgatgacctcatttttctcccacctcgcccacgcagat
gagcccgaccatcccattatcgatcagcaagctgcgaggtttcgggagactgtcgccgac
gccgagaagcacggacttgagactgggctcctgcatctctctaactctgcagcgacgatg
acccggccggacttgcgcttcgatatggtgcggccggggatcgcactctatgggctttct
cccgtcccagagcgcggacagatgggtttgaggccggccatgacggccagggcacgagta
gctctgatcaagcgggtcgcggccggcgagggtgtgtcgtacgggcacgtgtggattgcg
ccgcgagacacgacagttgcgctccttccggtcggttatgccgatggagtgtcccgcttg
ctcaccggcaagttcggggtgcagatcaacggtcaccgctacccggctgtgggtcgcgtc
tgtatggatcagttcgtagtagacctgggaccggggggtggcgctgagggtgctgcggct
gtgaaagagggcgatacggcagtgttgttcggtccaggagacgagggcgaatcgctggct
caggactgggcggatgcgctcggcaccattcactacgaggtcgtaaccggtataaagggg
cgcgcagtgcgtacctatatggggggttag

DBGET integrated database retrieval system