KEGG   Hoyosella subflava: AS9A_4177Help
Entry
AS9A_4177         CDS       T01514                                 

Definition
(GenBank) DNA ligase
Organism
asd  Hoyosella subflava
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AEF42610
UniProt: F6EK69
LinkDB All DBs
Position
complement(4302700..4303758)
Genome map
AA seq 352 aa AA seqDB search
MQLPVMPPLAPMLAKAAATVPEQAPDASAEPTWLYEPKWDGFRAIVFRDGDDVVIGSRGG
KDLSRYFPEVVTAVRDELPGRCVVDGEIVVPQSTEEGTRLDWEALSARIHPAERRVRQLS
VDTPALFVGFDLLAHHDRSLLDAPFGERRGMLTELAAAEIGPARCHVTRATNDAAVAQHW
FETFEGAGLDGVIAKRLASRYLPNKRELVKVKHSRTAEAVVIGYRPHKSQPGVGSVLLGL
YDGDELKMVGGMSAFTNAKRIKIQEDLDGIRSGDRAEGEVSRWRTSADAGFVPVRPERVA
EVAYDQMEGDRFRHAVRLLRWRPDRDPRSCTYDQLEVPVRYDLADVLEGSAR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacttccggtgatgcctcctttagcgccgatgctggccaaggccgccgcaaccgtc
cctgaacaggcgcccgacgcctcggccgaacccacctggctgtatgagcccaaatgggac
ggtttccgtgcgatcgtgttccgggacggagacgacgtagtgatcggctctcgtggcggg
aaggacctctcccggtactttcccgaggtggtgactgctgttcgtgacgagctgccaggc
cggtgcgtcgtcgatggcgaaatcgtcgtgccgcagagcaccgaagagggcacgcggctg
gactgggaagccctttcggcgcgcattcaccccgcagaacggcgggtgcgccagctttcc
gttgacaccccggccttgttcgtgggcttcgaccttctcgcgcatcacgatcgctctctg
cttgacgcccctttcggcgaacgacggggcatgctgaccgaactggccgcagcggagatc
ggtccggctagatgccacgtgaccagggcaactaatgacgccgcggtcgcgcaacactgg
tttgagacgtttgaaggcgccggcctcgacggtgtgatcgcgaagcggctggcctcgcgg
tacctgcctaacaagcgggagctggtcaaggtcaagcattcccgcacggcagaggcggtc
gtgatcgggtaccggccgcacaaaagccagccgggcgtcgggtcggtcctccttggcctg
tatgacggggacgaactcaagatggtcggcgggatgtctgcgttcaccaatgccaagcga
atcaaaattcaggaggaccttgacgggatccgttcgggggaccgcgcggaaggcgaggtc
tcacgctggcgtacgtccgccgacgcgggattcgtcccggtgcgacctgagcgtgtggct
gaagttgcgtacgaccagatggagggcgacagattccggcatgcggtgcggctcttgcga
tggcggccagaccgggatccccgatcgtgcacctatgaccagttggaggtgccggttcgc
tacgacttggctgacgtcctcgaagggagcgcgcggtga

DBGET integrated database retrieval system