KEGG   Actinoplanes sp. SE50/110: ACPL_1421
Entry
ACPL_1421         CDS       T02044                                 

Definition
(GenBank) undecaprenyl pyrophosphate synthetase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00900  Terpenoid backbone biosynthesis
ase01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACPL_1421
Enzymes [BR:ase01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     ACPL_1421
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AEV82318
UniProt: G8S3F8
LinkDB
Position
1485936..1486718
AA seq 260 aa
MSPRPPTPHISGARPPQLPSAAIPRHVAIVMDGNGRWAKERGLSRTKGHEQGEHSLFDAI
EGAIELGIPYLSAYAFSTENWKRSPEEVRFLMGFNRDVIRRRRDQLVDLGVRVVWSGRSG
RLWKSVIAELQTAEEMSRHNKTLTLQFCVNYGGQAEIADAAAAIARDVAAGKLRADKVTE
KTIAKYLYHPEVPEVDLFLRPSGEQRTSNFLLWQSAYAEMVYLDTLWPDFDRRHLWYACE
LYAQRDRRFGGALPNPVSPS
NT seq 783 nt   +upstreamnt  +downstreamnt
gtgagcccgcgtccgcccaccccgcacatctccggcgcccggccgccccagctgccgtcc
gcggcgatcccccggcacgtggcgatcgtgatggacggcaacggccgctgggccaaggag
cgcggcctgtcccgcaccaagggccacgagcagggcgagcactccctcttcgacgccatc
gagggcgccatcgagctgggcatcccctacctctcggcctacgcgttctccaccgagaac
tggaagcgctcgcccgaggaggtgcgcttcctgatgggcttcaaccgtgacgtcatccgc
cgccgccgcgaccagctggtcgacctcggcgtccgggtggtctggtccggccggtccggc
cggctgtggaaaagcgtgatcgccgagctgcagaccgccgaggagatgagccggcacaac
aagacgctcaccctgcagttctgcgtcaactacggcggccaggcggagatcgccgacgcc
gccgcggcgatcgcccgggacgtcgcggccggcaaactcagagccgacaaggtcaccgag
aagaccatcgcgaaatacctgtaccaccccgaggtccccgaggtcgacctgttcctgcgc
ccctccggcgagcagcgcacgtcgaacttcctgctctggcagtcggcgtacgccgagatg
gtctacctggacacgctctggcccgacttcgaccgccgccacctctggtatgcgtgcgag
ctctacgcccagcgcgaccggcgcttcggcggcgccctgcccaacccggtcagcccgtca
tga

DBGET integrated database retrieval system