KEGG   Actinoplanes sp. SE50/110: ACPL_4080Help
Entry
ACPL_4080         CDS       T02044                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00250  Alanine, aspartate and glutamate metabolism
ase00280  Valine, leucine and isoleucine degradation
ase00410  beta-Alanine metabolism
ase00640  Propanoate metabolism
ase01100  Metabolic pathways
ase01120  Microbial metabolism in diverse environments
Module
ase_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ACPL_4080 (gabT)
   00650 Butanoate metabolism
    ACPL_4080 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACPL_4080 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ACPL_4080 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACPL_4080 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ase01007]
    ACPL_4080 (gabT)
Enzymes [BR:ase01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ACPL_4080 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ACPL_4080 (gabT)
Amino acid related enzymes [BR:ase01007]
 Aminotransferase (transaminase)
  Class III
   ACPL_4080 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEV84975
UniProt: G8S5H5
LinkDB All DBs
Position
complement(4493601..4494941)
Genome map
AA seq 446 aa AA seqDB search
MNRLCRVSLEQKRRLVTALPGPRSQELMERKLAAVAGGVGTTMPVFAARAGGGIVVDVDG
NHLIDLGSGIAVTTVGAGAPRVVAAVTEQVAAFTHTCFMVTPYDGYVAVAEALNRVTPGD
HEKRSVLFNSGAEAVENAVKIARAHTGRDAVVVFDHAYHGRTNLTMAMTAKSMPYKHGFG
PFAPEVYRAPGSYPYRDAGVDGRAAAARAIDQIEKQIGADNLAALVIEPIQGEGGFIEPA
AGFLPALAAWCRANGVVFVADEVQTGFARTGDMFACDREGVVPDLIVTAKGIAGGLPLSA
VTGRAEIMDAPHAGGLGGTYGGNPIACAAALAAIETIEQDGLLARAREIETRVTGRLHDI
RDKDDRLGDIRGRGAMIAVELVRAGGREADPRLARDVARYAHQRGVIVLTCGTYGNVLRF
LPPLSITNELLDDAFDVLAAAFQEIR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagactgtgccgcgtgagcctcgaacagaagcgccggctggtcaccgcactgccc
ggcccccggtcccaggaactgatggaacgcaagctggccgcggtcgccggcggtgtcggc
accacgatgccggtgttcgcggcgcgggccggcggcggcatcgtggtcgacgtcgacggc
aaccacctgatcgacctcggctccggcatcgcggtcaccaccgtgggcgccggcgcgccg
cgggtggtcgccgccgtcaccgagcaggtggcggcgttcacgcacacctgtttcatggtt
acgccgtacgacggttacgtggccgtcgccgaggccctgaaccgcgtcacccccggtgac
cacgagaagcgcagcgtgctgttcaactccggcgcggaagccgtggagaacgccgtgaag
atcgcccgggcgcacaccggcagggacgcggtggtcgtcttcgatcacgcataccacggc
cggacgaacctgaccatggcgatgaccgcgaagagcatgccctacaagcacgggttcggg
ccgttcgcgcccgaggtgtaccgggcgcccgggtcgtatccgtaccgggacgccggcgtc
gacggccgggccgccgcggcgcgggccatcgaccagatcgagaagcagatcggcgcggac
aacctggccgcgctggtgatcgagccgatccagggcgagggcgggttcatcgagccggcc
gccggattcctgccggcgctcgccgcctggtgccgggccaacggcgtggtgttcgtggcc
gacgaggtgcagaccgggttcgcccgcaccggcgacatgttcgcctgcgaccgcgagggc
gtggtacccgacctgatcgtcaccgcgaagggcatcgccggcgggctgccgctgtccgcg
gtgaccgggcgcgccgagatcatggacgcgccgcacgccggcgggctgggcggcacctac
ggcggcaacccgatcgcctgcgccgcggccctcgccgcgatcgagaccatcgagcaggac
gggctgctcgcccgggcccgcgagatcgagacccgggtgaccgggcggctgcatgacatc
cgggacaaggacgaccggctcggtgacatccgcggacgcggcgcgatgatcgcggtcgag
ctggtccgggccgggggccgcgaagccgacccgcggctggcccgggacgtcgcccggtac
gcccatcagcgcggcgtgatcgtcctgacctgcggaacgtacggcaatgttctccgattc
ctgccgccgttgtcgatcaccaatgagctgctcgatgacgcgttcgacgtgctggccgcc
gcattccaggagattcgatga

DBGET integrated database retrieval system